KEGG   Cutibacterium acnes hdn-1: TIA1EST1_11510
Entry
TIA1EST1_11510    CDS       T03470                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00620  Pyruvate metabolism
pacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TIA1EST1_11510
Enzymes [BR:pacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     TIA1EST1_11510
SSDB
Other DBs
NCBI-ProteinID: AID37260
LinkDB
Position
2473451..2476831
AA seq 1126 aa
MVTQAHMDSVNLRLALNGLPLPTAARASYIDVVAPVLARQRELRRELPELLCPADRRIQA
FIDRYLGEDSSVHPRLPDTTLTLDEPGLARALSLPVDGDDFSSDLVSSYRVANGVLHNPR
NDRRTTAGVFHVAEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTSTQPVDRQA
HTWVSLLLRPLVVPEVPGFVSERRMEIRFFAPGGLVSNLDFVEGIFGNSGDPLLPVNDSA
LAPSGWTGHSGCIILAPHLNLIRKVDLGLPHVDQATDRQRRDGMCWSDESELYNEGKPFK
LCARDESGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYISHNEGQEY
ATPVCDQTVSDVVMANPDHFEMLSDGQARVLDIDDVVLVPGGTKFSLRDGTVSWDNGDHS
IRMRADTEYISPAGYRIHMVHNDADDQWYLEGTYGDSTTLHKCCTVSGGGKSEISKAISD
TFLWGNAYSPDFEADMDAVDDILHRDYSTRFADPKLNGIDHRPVLSTERSVGSVIKLLTP
SSDFTDWYNDWINSIPAFRKELVFTIKRYYKPEWGDDWRSHFSVAPTNGRHGNMVRLDGQ
KVLVSMARVGFQPDGSWRLFTLRHDYAPAVKVQTEDDMTASIVTSPGVVTGPEGLSRKVV
ANCEALLFQRPDDAIYRGYDTQTERDMSGTDLFISNYQPLTREDVRAMRDDVVAFSKFTP
PMRTFLSNFADSDPSEQPKFVVSSADPRLIDGVRSRNPRYLQVRPDIAKPRETAIANLAS
HLYHGLPIDEPLPLPVDVVAAGRRNNPPEGKIPALCAYNPLHYMELPELFMEFISSMTGK
SPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPKVEVAHDIS
LLVPEIFCRMSPAERDAKTLIEGGYLEKLEDYDKDGELILASRLGYRMTEKFMRAYFGRI
FLHPDTVFTPEMLRPELQDADIFADSVRTISTTHARVAKAYFDDGTVSLAVPPIRALLEI
MVNGVCSEGWTLDDPELREMFTRESVLASDWYAERIDAKQAEAVRRAERGIAHLEQFMAD
PRNASACEEIDVQARLDQVRKFHDRAVTAEYRQQLVGTLGRQVNFR
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggtcactcaagctcacatggattccgtgaatctaagactggcgctcaacggtctgcca
ctgccgacggctgcgcgcgcttcctacattgacgttgtcgccccagtcttggcccggcag
cgtgagctgaggagggaactccccgagctcctctgcccggccgaccgccgtattcaggca
ttcatcgaccgctacctgggcgaggactcttccgtccacccccgactgcccgacaccacc
ttgacccttgacgagcccggcctcgcacgggccctctcgctacccgtcgacggcgacgat
ttcagttccgaccttgtctcgagttaccgagtggccaacggcgtcctacacaatccccgc
aatgaccgtcgcaccactgctggtgtattccacgtcgccgagggcggactggcaatcccc
gacgacaagaaggccgtgccgatcgacgtcttcgcccgtctgctcgaccttgccttccag
gccccacccgagcacaccctgctgccttacacttctacccaaccggtcgaccgccaggcc
cacacctgggtttccttgttgctgaggcccctggtggtgcccgaagtgcccggtttcgtc
tccgagcgccgcatggagattcggttcttcgcccccggcgggctggtctccaacctggac
ttcgtggaggggatctttggtaacagtggcgatccccttctgcccgtgaacgactcggcc
ctcgccccgtcgggttggactggccacagcggctgcatcatcctcgccccgcatctcaac
ctcatccgtaaggtagacctcggtctgccccatgtcgaccaggcaaccgaccgtcagcgt
cgcgacgggatgtgctggtctgacgagtctgagctctacaacgagggcaagccattcaag
ctgtgtgcccgtgacgagtccggggtcatcctcactatcgtcgccgacaactacttcggc
tattgcaagaaggaggttaagacccagatctcctactcagctaacttgttcgggctggcc
gaggaggagcattccggcggcgcccgcgcctacatctcccacaacgagggccaggaatac
gccaccccagtctgcgaccagacggtttccgacgtcgttatggccaatccggaccacttc
gagatgcttagcgacggccaggcccgggtactcgatatcgacgacgtcgtcctggtgccg
ggtgggaccaagttcagcctgcgtgacggcactgtcagctgggataacggtgaccactcg
atccgaatgcgcgctgacaccgagtacatctcccccgccggctaccggattcacatggtc
cacaacgatgctgacgaccagtggtacctcgagggcacttacggcgattcgacgactcta
cataagtgctgcacggtatccggtggtgggaagtcggagatttccaaggccatatcggac
accttcctgtggggcaatgcctactctccggatttcgaggccgacatggatgccgtcgat
gacatcttgcatcgggactactcgacgcggttcgccgatcccaagcttaacggcatcgac
catcgtccggtcctctcgacggagcgttcggtgggttcggtcatcaagctcctcacccca
tcctcggacttcaccgactggtacaacgattggatcaactcgattccggccttccgcaag
gagctggtcttcaccatcaagcgctactacaagccggaatggggtgatgactggcgctcc
cacttcagcgtcgcccccacaaatggtcgccacggcaacatggtccgtctcgacggccag
aaggtgctggtgagtatggcgcgcgtgggattccagcccgacggctcgtggcggctgttc
accctgcgccacgattacgctccggccgttaaggtgcaaaccgaggatgacatgacagcg
tcaatcgtcacatctccgggcgtagttaccggccctgaaggtctgtcgcgcaaagtcgtc
gccaactgcgaagcgttgctcttccagcgccctgacgacgccatttaccgtgggtacgac
acccaaaccgagcgtgatatgagcgggacggacttgttcatctcgaactaccagccgctg
acccgcgaggacgtcagggcaatgcgtgacgacgtggtggccttctcgaagttcacccca
ccgatgcgcaccttcctgtcgaacttcgctgattccgacccttcggagcagccaaaattc
gtcgtctccagcgccgatcctcgtcttatcgacggggtgcgttcgcgcaacccacgctac
ttgcaggtgcgtccagacattgccaagccgcgcgaaaccgcaatcgccaatcttgccagc
cacctgtatcacggactgccgatcgacgaaccgctgcccctgccggtcgacgtggtcgcc
gccgggcgtcgcaacaacccgcccgagggcaaaatcccggccttgtgtgcgtacaaccca
ctgcactacatggagctgccggaattattcatggagttcatctcctcgatgactggtaag
agtccttcgacgacgggagccggttcggagggagccctgacgaaggcaccgttcaatgcc
ttgccagcggtcttcgacctcaactcgtccttcctgtccttcgtgctatcggggtatgat
ggttggttatcttcggccggattcatcggcccgaaggttgaggtcgcccacgacatttcc
ctgctcgtcccggaaatcttctgccggatgtccccagccgagagggatgccaagaccctt
atcgagggtggctatctggagaagctggaagattacgataaagatggcgaactcattctc
gcctcccgtctgggctaccgcatgacggaaaagttcatgcgcgcctatttcgggcgtatc
ttcttgcaccccgacaccgtcttcacccctgagatgctgcgtccggaacttcaggacgcc
gacatcttcgctgactcggtgcgaacgatctcgactactcacgctcgagtagctaaggcc
tatttcgacgacgggacggtctcgctggcggtaccgcccatccgggctctgctggaaatc
atggtcaatggagtttgctcggagggttggactcttgacgatcccgagttgcgggagatg
ttcacccgcgagtcagtacttgcctccgactggtacgccgagcgtatcgacgccaagcag
gccgaagccgtgcggcgcgccgagcgaggaatcgcccaccttgagcagttcatggctgat
ccgcgtaacgcgtccgcctgcgaggaaattgacgtccaggcccgtctggatcaagtccgc
aagttccacgatcgcgccgtgacggctgagtaccgccaacagttggtgggcactcttggt
cggcaggtcaacttccgctga

DBGET integrated database retrieval system