KEGG   Pigmentiphaga aceris: FXN63_04170Help
Entry
FXN63_04170       CDS       T06198                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pacr  Pigmentiphaga aceris
Brite
KEGG Orthology (KO) [BR:pacr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FXN63_04170 (ahpF)
Enzymes [BR:pacr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FXN63_04170 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin Thi4 DAO HI0933_like FAD_binding_3 Thioredoxin_4 K_oxygenase NAD_binding_8 YojJ
Motif
Other DBs
NCBI-ProteinID: QEI05119
UniProt: A0A5C0ASA6
LinkDB All DBs
Position
complement(1003511..1005127)
Genome map
AA seq 538 aa AA seqDB search
MLDASLKTQLKSYLEKVTQPIEIVASLDDGDKSREMLGLLQEIATLSSKITVIESRDDNE
RKPSFSINRTGSDIGVRFAAIPLGHEFTSLVLALLQVGGHTLKLDADVIEQIRNLDGDFS
FEAYVSLTCQNCPDVVQALNVMSVINPRIKVVTIDGGLFQDEVEARHIQAVPTMYLNGEV
FGQGRSSVEEILAKLDTGAVKRAAAKLDNLPTFDMLVVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKFAAALEQHVRAYDVDIINLQRAESLALNKGLV
EIKLASGATLRSRSVVLSTGARWREINVPGEQKYRNHGVAYCPHCDGPLFKGKRTAVVGG
GNSGVEAAIDLAGIVAHVTLIEFGHELRADAVLQKKLRSLPNVTVITNAQTTEITGDGKK
VNGLVYQDRASGAIHSVELEGVFVQIGLVPNTEWLKGTIALSKHGEIEVDARGQTSLPGV
FAAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRSSVTEDEDTEAPFVNEPADVAAMP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcctcgctcaagacccagttgaaaagctacctggaaaaggtcacgcagccg
atcgagatcgtcgcgtcgctggacgacggcgacaagtcccgcgaaatgctcgggctgctg
caggaaatcgccacgctgtcgagcaagatcacggtgatcgaaagccgcgacgacaacgaa
cgcaagccctccttcagtatcaaccgtaccggttcggacatcggcgtgcgcttcgccgca
attccgctcggacacgaattcacgtcgctggtcctggcattgctccaggtcggcggccac
acactcaagctcgatgccgatgtgatcgagcagatccgcaatctggatggcgatttcagc
tttgaggcctacgtctcgctgacctgccagaactgcccggacgtcgtacaggccttgaac
gtgatgtcggtgatcaacccgcgcatcaaggtcgtgacgattgacggcggtctgttccag
gacgaagtcgaagcacgccacattcaggctgtgccgaccatgtatctgaacggcgaagtt
ttcggccaaggccgcagcagcgtcgaagaaatcctggccaagctggacaccggtgccgtc
aagcgcgccgctgccaagctggacaacctgcccaccttcgacatgctggtcgtcggcggt
ggcccggctggcgcagccgccgccgtgtacgccgctcgcaagggcattcgtactggtgtg
gtagccgaacgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcg
gtgcaagaaaccgaaggcccgaaattcgctgccgcactggaacagcatgtgcgtgcctac
gacgtggatatcatcaacctgcaacgcgctgaatcgctggctttgaacaagggcctggtc
gagatcaagttggccagcggcgcaaccctgcgcagccgcagcgtggtcttgtccaccggt
gcccgctggcgcgaaatcaacgtgcccggcgaacagaagtaccgcaatcatggcgtggcc
tactgcccgcactgcgacggtccgctgttcaagggcaagcgcacggccgtggtcggcggc
ggtaactctggtgtcgaagcagcgatcgacctggccggtatcgtggctcatgtcacgctg
atcgaattcggccatgaattgcgtgcagacgctgtgttgcagaagaagctgcgcagcctg
ccgaacgtgaccgtgatcaccaatgcccagacgaccgaaattacgggcgacggcaagaag
gtcaatggcctggtctatcaagaccgtgcatcgggtgcgatccacagcgttgagctggaa
ggcgtgttcgtgcagatcggtctggtgccgaataccgagtggctcaagggcaccatcgcc
ttgtccaagcacggtgagatcgaagtcgatgcacgtggtcagacctcgctgccgggcgtg
ttcgctgctggtgacgtgaccacggtgccgttcaagcagatcatcattgctgccggtgac
ggtgcaaaggctgcgctgggtgcctttgaccacctgatccgctcgtcggtgacggaagac
gaagacacggaagcaccgttcgtgaacgaaccggctgacgtggctgcgatgccttga

DBGET integrated database retrieval system