KEGG   Pontibacter actiniarum: CA264_00615Help
Entry
CA264_00615       CDS       T05632                                 

Definition
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
pact  Pontibacter actiniarum
Pathway
pact00190  Oxidative phosphorylation
pact01100  Metabolic pathways
Module
pact_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CA264_00615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:pact00194]
    CA264_00615
Enzymes [BR:pact01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     CA264_00615
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     CA264_00615
Photosynthesis proteins [BR:pact00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   CA264_00615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N T3SS_ATPase_C ATPase NB-ARC RsgA_GTPase NACHT AAA_19 AAA_16 DUF1858 TrwB_AAD_bind ABC_tran AAA_7 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ARS34058
UniProt: A0A1X9YMG3
LinkDB All DBs
Position
135149..136660
Genome map
AA seq 503 aa AA seqDB search
MANIGRITQVIGPVVDVSFVGENSKLPNILDALQVTKDNGQVVVLEVQNHLGEDRVRTIA
MDSTEGLTRGAEVVDLGGPIKMPTGEGIKGRLFNVIGEAIDGIPQPVSTGGLPIHRPAPR
FEDLATSSEVLYTGIKVIDLIEPYAKGGKIGLFGGAGVGKTVLIQELINNIAKAHGGLSV
FAGVGERTREGNDLLREMIEAGIVRYGAEFLESLEHGGWDLSKVNQEELKESKATFVFGQ
MNEPPGARARVALSGLTMAEYYRDGEPGSSDAGRDILFFVDNIFRFTQAGSEVSALLGRM
PSAVGYQPTLATEMGAMQERITSTKRGSITSVQAVYVPADDLTDPAPATTFAHLDATTVL
SRKISELGIYPAVDPLDSTSRILTPDVVGDEHYNTAQRVKEILQRYKELQDIIAILGMDE
LSDEDKLVVHRARRVQRFLSQPFHVAEQFTGLKGVLVDIKDTIKGFNEIMDGKYDHLPES
AFNLVGTIEDAVAKGEKMMAEAK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattggcagaattacccaggttatcggtccagtggtggacgttagctttgtg
ggtgaaaactctaagctaccaaatattctggatgcccttcaggtgacgaaagacaacggc
caggtagtagtgctggaagttcagaatcacttgggtgaggaccgcgtgcgtaccattgcg
atggactctacagaaggccttactcgtggcgctgaagtagttgacttgggtggcccaatc
aaaatgccgacaggcgaaggcattaaaggtcgccttttcaatgtgatcggcgaagccatt
gacggtattccgcagccagtgagcacaggtggtcttcctatccaccgacctgcgcctcgc
ttcgaagaccttgctacttcttctgaagttctttatacaggtatcaaagtaatcgacctg
atcgagccttatgcaaaaggtggtaaaatcggtcttttcggtggtgccggtgtaggtaaa
accgtattgatccaggagctgatcaacaacatcgcgaaagcacacggcggtctttctgta
tttgccggtgtaggtgagcgtacacgtgagggtaacgacttacttcgtgagatgatcgag
gctggtatcgtgcgctacggcgctgagttccttgagtcgctggagcacggtggctgggat
ctttccaaagtaaatcaggaagaactgaaggagtctaaggcgaccttcgtcttcggccag
atgaacgagcctcctggggcgcgtgcacgtgtggcgctttccggtcttacaatggcggag
tactaccgcgatggtgagccaggctcaagcgacgccggccgtgacatcctgttcttcgta
gataacatcttccgcttcacgcaggcgggttctgaggtgtcggcccttctggggcgtatg
ccatctgcggtaggttaccagccaacgctggcaactgaaatgggtgccatgcaggagcgc
atcacgtctacaaagcgtggttccattacatccgtgcaggccgtttacgtacctgcggat
gacttgactgacccggctccggcaactacgtttgcccacctggatgctactaccgtactt
tcccgtaaaatctccgagcttggtatctaccctgcggtagaccctctggattctacatca
cgtatcctgacgccagacgttgttggtgacgagcactacaacacagcgcagcgtgtgaaa
gagatcctgcagcgctacaaagagcttcaggacatcatcgccatcctgggtatggacgag
ctttctgacgaggataaactggtggtacacagagcgcgccgtgtgcagcgtttcctgtct
cagccgttccacgtagcagagcagttcacaggcctgaaaggtgtgcttgttgatatcaaa
gacaccatcaaaggcttcaacgagatcatggacggtaagtatgaccaccttccggagtca
gccttcaacctggtaggtaccattgaagacgctgttgccaaaggtgagaaaatgatggcc
gaagcaaaatag

DBGET integrated database retrieval system