KEGG   Pontibacter actiniarum: CA264_05310Help
Entry
CA264_05310       CDS       T05632                                 

Definition
(GenBank) sigma-54-dependent Fis family transcriptional regulator
Organism
pact  Pontibacter actiniarum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 HTH_50 AAA_5 AAA_2 HTH_28 HTH_23 ABC_tran MCM AAA AAA_29 Mga DUF5451 RWP-RK HTH_22
Motif
Other DBs
NCBI-ProteinID: ARS34903
UniProt: A0A1X9YPV2
LinkDB All DBs
Position
complement(1230163..1231440)
Genome map
AA seq 425 aa AA seqDB search
MRNIDIQSIKQRFGIIGNSPLLNYAIQVAAQVAPTDMTVLITGESGSGKESFSKIIHQLS
PRKHGQFIAINCGAIPEGTIDSELFGHEKGSFTGAQDARKGYFEVTDGGTIFLDEIGEMP
LGTQARLLRVLENGEFIKVGSSKVQKKDVRVVAATNVNLMKAVEKGSFREDLYYRLNTVP
ISVPPLRERGNDIYLLFRKFASDFSDKYKVQPISLTPDAVQELQAYRWPGNIRQLKNIVE
QISVLEYDREVDAETLRRYLPRDQGSQLPALLAKENSAEGQISERDLLYKVLFDMRRDMS
ELKKLVFDMLAHQPNDEELLREHSHLFENMEQPSYNGRNYPQEPLQHEPYYLPVKHSQPQ
DYEEDKVEDIPHETEEESLSLEDKEKELILKALKKHNNKRKYAAQDLGISERTLYRKLKQ
YDIED
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatatcgatatacaaagtataaaacagcgcttcggcattatcggaaactccccc
ctgctgaactatgccatacaggtggcggcacaggtggcccccaccgacatgacggtgctc
atcaccggcgagagcggcagcggcaaggagtctttctccaagatcatccaccagctcagc
ccgcgcaagcatggccagtttattgccatcaactgcggcgccataccggagggaaccatc
gactcagagctgttcggccacgaaaaaggctcctttaccggggcgcaggacgcgcgcaaa
ggctatttcgaggtaacagacggcggcaccattttcctggacgagatcggtgaaatgccc
ctcggaacgcaggcccgcctgctgcgcgtacttgagaatggcgagttcattaaagtaggc
tcttccaaagtgcagaaaaaggatgtgcgggtggtggcggccaccaacgtgaacctgatg
aaggctgtggagaaaggcagcttccgggaagacctgtactaccgcctgaacacggtgccc
atttcggtgcctccgctgcgcgagcgcggcaacgacatttacctgctgttccgcaagttc
gcctccgacttttcggacaagtataaagtgcagccgatctccctgactccggatgccgtg
caggaactgcaggcgtaccgctggccgggtaacatccgccagctaaaaaatatcgtggag
cagatctcagtgctggagtacgaccgtgaggtggacgcagagacgctgcgccgctacctg
ccgcgcgaccagggctcccaactgccagccctcctggccaaggagaactccgcagagggg
cagatctccgaacgcgacctgctctacaaggtgctctttgacatgcgccgcgatatgtcg
gaactcaagaagctggtgttcgacatgctggcccaccagccgaacgacgaggagttgctg
cgggagcacagccacctgttcgagaacatggagcagccctcctacaacgggcgcaactac
ccgcaggagccgctacagcacgagccatactacctgccggtaaagcacagccagccgcag
gactatgaggaagacaaagtagaggacattccgcacgaaacagaggaagaaagcctatct
ttagaggacaaagaaaaggagctcatcctgaaggcgctgaagaagcacaacaacaaacgc
aagtatgccgcacaggacctgggcatttcggagcgcaccctgtaccgcaaattaaagcag
tatgacattgaagactaa

DBGET integrated database retrieval system