KEGG   Pontibacter actiniarum: CA264_05530Help
Entry
CA264_05530       CDS       T05632                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pact  Pontibacter actiniarum
Pathway
pact00620  Pyruvate metabolism
pact00680  Methane metabolism
pact01100  Metabolic pathways
pact01120  Microbial metabolism in diverse environments
pact01200  Carbon metabolism
Module
pact_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA264_05530
  09102 Energy metabolism
   00680 Methane metabolism
    CA264_05530
Enzymes [BR:pact01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CA264_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARS34945
UniProt: A0A1X9YPZ0
LinkDB All DBs
Position
1284041..1286626
Genome map
AA seq 861 aa AA seqDB search
MNRINQHTSSAVEVFRSEVGTRFEMYNSLFSSLPFHRVEKTGVLLSLFVLHCEEGYQRHL
SPRKIISSFFEQYTTYRTDQEQHDLLFRFVQYAERQVVLFDALEEAAFRDTHDMYGVGTL
KQLGAAVVQANAEPRLAEKLKNFAVRLVLTAHPTQFYPSNVLGIINDLSQALATDNTSLA
HSYLRQLGKTPFFKKEKPTPYEEAVNLIWFLENVFYKAGGNILTSLKNQFPEAVQRNSQL
VRMGFWPGGDRDGNPFVKADTTLRVADALRGAVVRSYYADVRRLKRRLTFKGVESLLKEL
ETKLYNNLFVPGYSFDLTKEDILDTLRQISALLIEEHSSLFLNQVEALINRVELFGLYFA
SLDIRQDSSVHTHLFEELSLVTDAIPGDYTEQSEEEKINLLRSVSEQVDPAVLEDETLRD
TLEVIGAIKTIQEYNGEEGCHRYIISHSTSALNVMEVYTLFRLGGWQPEELTVDIVPLFE
TIADLGHAAGVMRELYENEVYRSHLHRRHNIQTIMLGFSDGTKDGGYFMANWSIYKAKEA
LTQVSREYGLEVIFFDGRGGPPARGGGKTQQFYASMGSNIANQEIQLTVQGQTISSNFGN
VDSAQFNMEQLIHAGISNALFSQKGATLSGQEDTLLQQLANISYEAYSKLKNHRVFLEYL
NYISPLRYYGEANIGSRPSKRKAGKLNLDDLRAVPYVGAWSQLKQNLPGYYGVGIALEKM
HESGRWEFLQKLYKESLYFKTLLDNCEMAMKKCFFPVTAYLAEHPKYGELWRIIHEEYER
TRKYVLMLSQASELMADKPIEQLSIQTRQRIELPLITIQQYALANIREIEEQHPQSQAKQ
VYEKLVVRCSFGIINAERNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaataaaccaacatacaagcagcgccgtggaggtgtttcgcagcgaagtaggc
acccgttttgagatgtataacagcctgttttcgtcgttgcccttccatagggtggagaaa
acaggggtgttgctgtcgctttttgtgctgcactgtgaggaaggctaccagcggcacctc
agccccaggaaaataatcagcagcttctttgagcagtacaccacgtatcgcaccgaccag
gagcagcatgacctgctgtttcggttcgtgcagtacgcagagcggcaggtggtgctgttc
gatgccctggaggaggcggccttccgcgacacgcacgacatgtacggtgttggaacattg
aaacagttgggcgcagccgttgtgcaggcgaacgcagagccccggctggcggagaagctg
aagaactttgccgtgcggctcgtgctcacggcgcacccgacccaattctacccaagcaat
gtgctggggattatcaacgacctgtcgcaggcgctggcgacggacaatacttcgctggcg
cactcgtacctgcggcagctgggtaaaacgcccttcttcaaaaaagaaaagcctacgcct
tacgaggaggccgtgaacctgatatggtttctggaaaacgtgttttacaaggcgggcggc
aacatcctgacctctcttaagaaccagtttccggaggcggtgcagcgtaacagccagctg
gtgcgcatgggcttctggcccggcggcgaccgggacggaaacccttttgtgaaagccgat
accaccctgcgtgtggcggatgccctccgtggggccgtggttcggtcttactatgcggat
gtgcgccggctgaaacgaaggctcacctttaaaggcgtagaaagcctgctgaaagagctg
gaaacaaagctgtataataacctgtttgtgcccggctacagcttcgacttgaccaaggaa
gacatcctcgacaccttgcggcagataagtgcgcttttgatcgaggagcacagcagcttg
ttcttaaaccaggtggaggcgttgattaaccgggtagagctgttcgggctgtactttgcc
tcgcttgatattcgccaggacagctcggtgcacacgcacctgtttgaggagctatcgctg
gtaaccgacgctatccccggcgactacacggaacagtcggaggaggagaaaattaacctg
ctgcgctccgtttcagagcaagtggacccggcggtgttagaggacgagacgctgcgtgac
accttagaggttataggcgccatcaaaaccatacaggagtacaacggagaggagggatgc
caccgctacattatcagccacagcaccagtgctttaaacgtgatggaggtgtacacgctg
tttcgcctgggaggctggcagccagaggaactgacagtagacattgtgccgcttttcgag
actattgccgacttaggccatgcggccggcgtgatgcgggagctgtatgagaacgaagta
taccgcagccatctgcaccgccgccacaatatccagaccatcatgctcggcttttcggat
ggcactaaagacggtggctattttatggcgaactggagcatttacaaagccaaagaggca
ctcacgcaggtatcacgggagtatgggctagaagtgatattttttgatgggagaggaggc
ccgccagcacggggaggcggtaaaacacagcagttttacgcctccatgggcagcaatatc
gcaaaccaggagattcagctaaccgtgcaggggcagaccattagctctaacttcggcaac
gtggattctgcccagtttaacatggagcagctgatccacgccggaatcagcaacgcgctg
ttctcacaaaaaggcgccaccttatcgggtcaggaggacaccctgttgcagcaactggcc
aacatcagctacgaagcctacagcaaactgaaaaaccaccgggttttcctggagtacctc
aactatatcagcccgttacgctactacggcgaagcaaacatcggcagccggccatccaag
cgcaaggcgggtaagctaaacctggacgacctgcgggcagtgccgtatgtgggggcctgg
agccagctgaagcaaaacctgcccggctactacggggttggtatcgctttagagaaaatg
cacgaaagcggccgttgggagtttctccagaagctgtacaaggagtcgttatactttaag
acactgctcgataactgtgaaatggctatgaagaaatgctttttcccggtgacggcatac
ttggccgagcatccaaagtatggtgagctgtggcgcattatccacgaggagtatgagcgc
accaggaaatatgtgctgatgctgtcgcaggcaagcgagctgatggcggataagcccatt
gagcagctgtcgattcagacacgccagcgcattgagctgccgctcatcaccattcagcag
tacgcgctggccaacatccgtgaaatcgaggagcagcacccgcagtcgcaggcaaagcag
gtgtatgagaagctagtggtgcgctgctcgttcggaattattaatgcggagcggaattca
gcgtaa

DBGET integrated database retrieval system