KEGG   Pontibacter actiniarum: CA264_06510Help
Entry
CA264_06510       CDS       T05632                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pact  Pontibacter actiniarum
Pathway
pact00500  Starch and sucrose metabolism
pact01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CA264_06510
Enzymes [BR:pact01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CA264_06510
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CA264_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ARS35121
UniProt: A0A1X9YQJ8
LinkDB All DBs
Position
1503884..1505533
Genome map
AA seq 549 aa AA seqDB search
MTEELWYKNAIIYSLDLETFMDSNSDGVGDFGGLARRLDYLHAMGIDTVWLAPFQPTPNK
DNGYDIKDYYGVDPRHGSSGNFVEFMHQANKRGIKVIIDLVVNHTSDQHPWFQDARSSED
AKHRDWYVWSKERPSDWNEGMVFPGVQEATWTYDKAAKAYYFHRFYKFQPDLNIDNPKVR
EEIHRIMGFWLELGVAGFRVDAVPFILESPAPGKAKSKQNFEYLRDMRRFLQWRKGDAIL
LGEANVLPKESKQYFGEEGSGIQLMFNFYVNQYMFYALATGDIAPLVEALEATRVAFPVS
QWAHFLRNHDELDLGRLTDEQRQKVFARFGPEKYMQLYDRGIRRRLSPMLGNRQQTELAY
SLMFSLPGTPVIRYGDEIGMGDDLSLKERDAVRTPMQWSDDKQAGFSKADKLVHPVIDEG
PYAYRHVNVENQRREPDSLLNWMTTLIRLRQECSEIGWGDWRLVDTGKPHVLGMHYSWQG
SSLLIFHNFDEKAHEIVLNLKESKEAKLVDLMVKYVSVADEKGSHHITLDAYGYRWFRAD
DISHLMKKD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagagctatggtataaaaacgcgattatctacagccttgacctggaaaccttc
atggactccaacagcgacggcgtgggcgacttcggcgggcttgccaggcgcctggattac
ctccatgccatgggcatcgatacggtgtggctggccccttttcagcccacgccaaacaaa
gacaacggctacgatattaaagactattacggtgtggaccccaggcacggctccagcggc
aactttgtggagttcatgcaccaggcaaacaagcgcggcattaaggtcattattgattta
gtggtaaaccatacttctgaccaacatccctggtttcaggacgcgcgcagcagcgaagat
gccaagcatcgtgactggtatgtgtggtcgaaggagcggccctccgactggaacgagggc
atggtgtttccgggagtgcaggaggctacctggacctatgataaagcagcgaaagcttac
tatttccaccgcttctacaagtttcagccagacctcaacattgataaccccaaggtaagg
gaagagattcaccgcatcatgggcttttggctggagctgggggtagcgggctttcgggtg
gatgccgttccttttatcctggaatcaccggctccgggcaaggcgaaatcgaagcagaac
ttcgagtacctgcgcgatatgcgccgctttctgcagtggcgcaagggagatgccattttg
ctgggcgaggccaatgtgctgcccaaagagagcaagcagtatttcggggaagagggaagc
ggcatacagctgatgtttaacttttacgtgaaccagtacatgttttatgccctggctacc
ggcgacatagccccgctggttgaggccctggaagcaacgcgcgtcgcgttcccggtttcg
cagtgggcgcactttctgcgcaaccacgacgagctggacctggggcggctgacagacgag
cagcggcagaaagtatttgcccgcttcggccctgagaagtacatgcagctctacgaccgg
ggcatccgcaggcgcctctctcctatgctgggaaaccggcagcaaacggagctggcctat
agccttatgttttcccttccgggcacgcctgtgatccgttacggggacgagattggaatg
ggcgatgacctgagcctgaaggagcgggatgccgtccggacgcctatgcagtggtcggat
gataagcaggctggcttctcgaaggcagacaagctggtgcaccccgttattgacgagggg
ccgtacgcctacaggcatgttaacgtggaaaaccagcggcgcgagccggactcgctgctg
aactggatgaccactctgatacgcctgcggcaggagtgcagcgaaataggctggggtgat
tggaggctagtggataccggtaagccgcatgtactgggcatgcattacagctggcagggc
agctcactgttaatctttcacaactttgatgagaaggctcatgagatcgtgctgaacctg
aaggagagcaaggaggccaagctggttgacctgatggtaaagtatgttagcgttgccgat
gagaaaggcagccaccacattacgctggatgcgtacgggtaccgctggttccgggcagat
gacataagccatttgatgaaaaaggattag

DBGET integrated database retrieval system