KEGG   Pontibacter actiniarum: CA264_11355Help
Entry
CA264_11355       CDS       T05632                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pact  Pontibacter actiniarum
Pathway
pact00564  Glycerophospholipid metabolism
pact01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CA264_11355
Enzymes [BR:pact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CA264_11355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Lycopene_cycl HI0933_like Pyr_redox_2 FAD_binding_3 Pyr_redox_3 NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: ARS37828
UniProt: A0A1X9YY58
LinkDB All DBs
Position
complement(2631189..2632751)
Genome map
AA seq 520 aa AA seqDB search
MWDVIVIGGGATGLGVGVDAASRGFRTLLLEQSDFAKGTSSRSTKLVHGGVRYLAQGDVS
LVFEALRERGLLIQNAPHLVHRQPFVIPSYSWWNKMFYGIGLNVYDWMAGRYRLEKTSFL
SKAAVTRLLPNVRKEGLAGGIMYYDGQFDDARLAVNLAQTCVEQGGVALNYMKVDGLLKD
GSGKVAGVQVHDVESGEAYELKAKVVVNATGVFVNEVLQMDAPKQQPLVRPSQGVHVVID
RSFLKGDNALMLPKTPDGRVLFAVPWHGHVLLGTTDTPLDEHSLEPRALEQEIDFILQTA
GQYLEQKPTRQDVLSVFAGLRPLAAPTKNSGSTKEISRSHKLIVAASGLITITGGKWTTY
RKMAEDTVDKAIALAGLPFRPCNTEGLQIHGAINEKSNILKPLSIYGADARGVEELVQQQ
PGLGRPLHKKFSHIQAEVVWAARHEMARTVEDVLARRLRVLFLDAKAAIDMAPQVAELMA
TELGHDAAWQQDQVRVFTQLAGQYLLEPYSKATPAAVDQI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggatgtcatagtaataggagggggggctaccggattgggagtaggtgtcgacgct
gcgtcgagaggctttcggacgctgctcctggagcagtctgactttgcaaaaggaacctcc
agcaggagtacaaagctggtgcatggcggtgtgcgctacctggcacagggtgatgtaagc
ctggttttcgaagccttgcgcgaaagggggctgctgattcagaacgcaccgcacctggtg
cacaggcagcccttcgttattcctagctacagttggtggaacaagatgttctacggcata
gggctcaacgtgtatgattggatggcggggcgctaccgcttggagaaaacctctttcctg
agcaaagcggccgttacgcggctcttgccaaacgtgagaaaagaaggccttgccggggga
attatgtattatgacgggcagtttgacgacgccaggctggctgtaaacctggcgcagacc
tgtgtggagcagggtggagtggcgcttaactatatgaaagtcgatggcctgctgaaggac
ggaagcgggaaagtggccggcgttcaggtgcacgatgtggaaagcggagaggcttatgag
ctgaaggcaaaggtggtggtaaacgcaaccggtgtgtttgtgaacgaagtgttgcagatg
gatgcccctaagcagcagccgctggtaaggccgagccagggagtgcacgtggtcatagac
cgctcctttctgaagggggataatgcgctgatgcttccaaagactccggacggacgcgtg
ttgttcgctgtgccatggcatgggcacgtgctgttaggaacaacagatacaccactggat
gagcatagcctggagccaagggcgctggagcaggaaattgactttatcctgcagacggcc
gggcagtacctggagcaaaaaccgacacggcaggatgtgttaagcgtgtttgccgggctg
cgccccttagcggccccaacaaaaaattctggcagtacgaaagagatttccagaagccat
aaacttatcgtggccgcatccggcttaattaccataacaggcggtaaatggaccacttac
cgcaaaatggcagaggatactgtagataaggccattgccctcgcaggcttgcctttcaga
ccatgcaataccgaaggcttacaaatacatggggctataaatgaaaaaagtaatatattg
aaaccccttagcatctatggcgcagacgccaggggagtggaagagctcgtgcagcagcag
ccgggcctgggcaggcccttgcacaaaaagttttcgcacatacaggcggaggtggtttgg
gcagcgcgccatgagatggccagaacagtggaggatgtgctggcccggaggctgcgggtc
ctgtttctagatgcgaaggcggccattgacatggcgccgcaggtggctgagctcatggca
acggagctggggcatgatgcagcatggcaacaggaccaggtgcgcgtctttacccagctt
gcggggcagtacctgttagagccctacagtaaagcaacacctgcagcggttgatcagatt
taa

DBGET integrated database retrieval system