KEGG   Pontibacter actiniarum: CA264_14465Help
Entry
CA264_14465       CDS       T05632                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
pact  Pontibacter actiniarum
Brite
KEGG Orthology (KO) [BR:pact00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pact03012]
    CA264_14465
   03029 Mitochondrial biogenesis [BR:pact03029]
    CA264_14465
Translation factors [BR:pact03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    CA264_14465
 Prokaryotic type
   CA264_14465
Mitochondrial biogenesis [BR:pact03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CA264_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 GTP_EFTU_D2 RsgA_GTPase Arf Ras SRPRB Roc FeoB_N GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: ARS36534
UniProt: A0A1X9YUS2
LinkDB All DBs
Position
3393501..3396584
Genome map
AA seq 1027 aa AA seqDB search
MAEEKTRRLKQVATTLNIGTSTIVDYLSAKGFEVENKPTTKITAEQFGMLAKEFASSMQE
KQEADEIHIGKKPQSNQVVESEPAAQEPKKQSEPEEEILIKNASAPKAPEAPAPTPAPAP
AKEEEPASKLPGIKILGKIDLDAKGRPVTKQPEPEQKPAPEAPKAEEKPAPAPEAPKPAA
PEVPKAEEPAKPAAVTPAPEAAAPKAEEPAKPQQPKAPKAEEKPAQPEAKAPEAPAKPQQ
PEAPKQPSTPAAEKPAAPAPKQPEAEKAPQQPATPAEANKGTETKEDIEKITAKADQLKG
LTVLGKIELPTESRRKGAKPAASSDDRKKKKKRKRIMVATEGGQPGAAQGQGQGNQRPTQ
PAQQGNRPDRGNQRPARPAKGRGAARPEKAEVTDKQIQEQIKATLAKLSGGKGGGGNRAK
YRREKRSAIADATEERRMQEQAESKTLRVTEFVSANDLASLMDVSVNDVIKVCMQLGMFV
SINQRLDAEAITIIADEFGYNVEFITTEEEQGLEDIVEENEEDLKERAPVVTIMGHVDHG
KTSLLDYIRSANVTAGEAGGITQHIGAYKVQTESGRTITFLDTPGHEAFTAMRARGAKVT
DVVIIVVAADDSVMPQTKEAINHAQAAGAPIIIALNKIDKPGANPDKVREELAQMNVLVE
EWGGKYQAQEVSAKTGQGVPDLLEKVLLEAELLELKANPERQAIGTVIEASLDKGRGYVA
TVLVQTGNLKIGDVVLAGSHYGRVKAMTDHRGKKMKEAGPSTPVQLLGLDGAPQAGDKFV
VMDSEREAREIASNRSQLQREQSLRTRKHITLDEIGRRLAIGTFKELNVIVKGDVDGSVE
ALSDSLLKLSTPEVQVSIINKGVGAISESDVLLASASDAIIIGFQVRPSVNARRLAEQEQ
IDVRLYSIIYDAINEVKDAMEGMLAPTLKEEITGNVEVREVFKISKVGTIAGCMVTDGTI
QRNAKVRLVREGIVVHDGEILALKRFKDDVAEVRQGYECGISLRGYNDIQVGDVIEAYVE
KEVKRTL
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaaaaacaaggaggcttaaacaggttgcgactactttaaacattggtaca
tccacgatcgtggattacctctctgctaaagggtttgaggtggaaaataaaccaaccacc
aaaatcacggcagagcagttcggtatgctggctaaagaattcgcatcctcaatgcaggaa
aagcaagaggcagatgagattcacatcggtaaaaagccacagagcaaccaggtagttgag
tcggagccggcagcacaggagcctaaaaagcaaagcgagcctgaagaggagatcctcatc
aagaacgcaagcgctccgaaggcaccagaggcgccagcgccaacacctgcccctgcccca
gcaaaagaggaggagcctgcatctaagctgccgggaataaagatactcggcaaaatcgac
ctggacgcaaaaggcagaccagtaacgaaacaaccggaaccggagcagaagcctgcaccg
gaggcacccaaagcagaggaaaagccggcaccagccccggaagctccaaagccagcggca
ccagaagtgccaaaagcggaagagccagccaagcccgctgccgtaacgccagctccagag
gccgctgctcctaaagctgaagaaccagccaaaccacagcagccaaaagcaccgaaggca
gaggaaaagcctgctcaaccggaagccaaagcgcctgaggcacctgccaagcctcagcag
ccagaagctccgaagcagccaagcacgccggcagcagaaaaaccagctgcaccagcacca
aaacagccagaagcagagaaggcgccacagcaaccggccactcctgcagaggcaaacaaa
ggcacagaaaccaaagaagatatagaaaagatcacagcaaaagcagaccaacttaaaggt
ctgactgtactcggcaaaattgaactgccgacagaatcgcgtagaaaaggcgccaagcct
gccgcctcttctgatgaccgcaagaagaagaagaagcgcaaacgtattatggtggccaca
gaaggtggccagccaggagccgctcagggccagggacagggaaaccagcgcccgacacag
cctgcccagcaaggcaaccgcccagaccgtggtaaccaacgcccggcaagacctgccaaa
ggcagaggagctgcaaggcctgagaaagcagaggttaccgataagcagatccaggagcag
attaaggctacacttgccaaactgagcggtggtaaaggcggcggcggtaaccgcgccaag
tatcgccgtgaaaagcgctcagctattgctgacgccacggaggagcgccgtatgcaggag
caggcagagtctaagacactgcgtgtaactgagttcgtatctgcgaacgacctggcctcc
ctaatggatgtgagcgtgaacgacgtgatcaaggtatgtatgcagttggggatgttcgtg
tccatcaaccagcgccttgacgccgaagccatcaccatcattgctgatgagttcggctac
aacgtagagttcatcaccaccgaggaagagcaaggcctggaggatattgtagaggagaac
gaggaagacctgaaagagcgtgccccagtggtaaccatcatgggccacgttgaccatggt
aaaacatcgttgcttgactacatccgtagcgccaacgtaacagccggtgaggccggcggt
atcacgcagcacatcggtgcctacaaggtacagacggaaagcggccgcaccattaccttc
ctggatacaccgggtcacgaagcctttacggcaatgcgtgcccgtggtgccaaggtaaca
gacgttgttattattgtggtagcagcagacgactctgtgatgccgcagacgaaggaggcc
atcaaccacgcacaggcggcgggtgccccaatcatcattgcgctgaacaaaattgataag
ccaggagcaaacccggacaaagttcgtgaggagcttgcccaaatgaacgttctggtagag
gaatggggtggtaagtatcaggcgcaggaagtttcggcaaaaaccggccagggcgtacct
gaccttctcgagaaagtattgctggaggcagaactgcttgagctgaaagctaacccagag
cgccaggcaatcggtaccgtaatcgaagcctcgctggacaaaggccgcggttatgttgcc
accgtactggtacagactggtaacctgaaaataggtgatgtggtactggcaggctctcac
tacggtagggtaaaggccatgaccgaccaccgcggtaagaaaatgaaagaggccggtcct
tctaccccggtacagttactgggtctggatggcgcgccacaggcaggtgataagttcgtg
gtaatggactctgagcgtgaagccagagaaatcgcctctaacagatcgcagcttcagcgt
gagcaaagcctgcgtacacgtaagcacattacactggatgagatcggtcgccgtttggca
atcggtacgtttaaggagctgaacgtgattgtgaaaggtgacgtggacggttccgtagag
gcgctttccgactccctgttgaagctgtctacgcctgaggttcaggtgagcatcatcaac
aaaggtgtgggtgccatctcagaatcagacgtgctgcttgcctctgcctctgacgccatt
atcattggcttccaggttcgtccgtctgtgaacgcacgcaggctggctgagcaggagcaa
attgatgtgcgcctgtactctatcatctacgatgcgatcaacgaggtgaaggatgccatg
gaaggtatgcttgcccctaccctgaaagaggagattactggtaacgtagaagtacgtgag
gtattcaagatcagcaaggtgggtaccattgcaggttgtatggtgacagacggtactatt
cagcgtaacgccaaggtacgtctggtacgtgaaggcatcgtggtacacgatggagagatc
ctggctctgaagcgattcaaggacgacgtagcagaagtaagacaaggctacgagtgcggt
atcagcctcagaggatacaatgacatccaggtaggtgacgtaattgaagcttacgtagaa
aaagaagtgaaacgtacgctgtag

DBGET integrated database retrieval system