KEGG   Pontibacter actiniarum: CA264_15355Help
Entry
CA264_15355       CDS       T05632                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pact  Pontibacter actiniarum
Pathway
pact00473  D-Alanine metabolism
pact01100  Metabolic pathways
pact01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CA264_15355
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CA264_15355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pact01011]
    CA264_15355
Enzymes [BR:pact01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CA264_15355
Peptidoglycan biosynthesis and degradation proteins [BR:pact01011]
 Precursor biosynthesis
  Racemase
   CA264_15355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ARS36683
UniProt: A0A1X9YV06
LinkDB All DBs
Position
complement(3596828..3599284)
Genome map
AA seq 818 aa AA seqDB search
MLTFQQLQSIVQGREVQFVQPLPVVHLLTDSRKLSQPAGTVFFAVRGKYNDGHQYLPQLY
AQGVRAFVVEQGEPGELATRYPEANILLVESSLEALQQLAAWHRSQFSIPVIGVTGSNGK
TIVKEWLSQLLSPDELVVKSPRSYNSQLGVPLSVWQLQPNHTLAIFEAGISQPGEMERLQ
QVIQPTLGVFTNVGSAHDEGFASREQKIAEKLKLFQGVELLFYCADYELLHQAVQAQGIK
SFTWSRHQPEANLFINATTTAGQKTIVVYTYQGEKQRLAIPFTDEASVENALHCLALLLY
RRLPLSEVQDRLDRLHPVAMRLEMKEAINGCYLIDDTYNNDLAGLAIALDLQASQPQRGR
RTLILSDVLESGLPEEQLYEKVAGLAQAHKVQRLIGIGPTISKYAHLFPQGSFYTSTADF
LQAFDASSFRGELILVKGARVFGFEKIVQAFQQKVHGTVLEVNLDALVHNLNYYRSRVAP
ATKLMVMVKAFAYGSGSFEVANLLQFHRVDYLAVAYVDEGVALRENGITLPIMVMNPSQD
SFAKLRQYNLEPEIYSVEQLQDFVSSLEPEATYKIHLKLDTGMHRLGFVPEDFEALFELL
HRYPQVQVASTFSHLAGADEAVHNDFSQLQVSRFRSMAAAVEERLKYKVIKHILNSAGIV
RFPEHQLDMVRLGIGLYGVEATGSEQEALRPVSTLKTTVSQVKSIKQGETVGYSRKGIAS
SDRTTATIAIGYADGYDRRFSNGVGQVLINGHRCPLIGNVCMDMCMVDVTGVAVKAGDVA
IVFGPQLTLVELAQSIGTIPYELLTNVSTRVKRVFYAE
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgtttcagcaactccaatccatcgttcagggcagggaagtacaatttgtgcag
ccgctgcccgtcgtgcacctgctcaccgacagccgcaagctctcccagccggccggcacg
gtgttctttgccgttcgggggaaatacaacgatgggcaccagtacctgccgcagctctac
gcgcagggggtaagggcttttgtggtggagcagggggagccgggagaactggcaacgcgg
tacccggaggccaacatcctgctggtagagagtagcctggaggcgctgcagcaactggca
gcatggcaccggtcgcagtttagcatcccggttatcggcgtgacgggcagcaacggcaaa
accattgtaaaagagtggctgtcgcagctgctgagccccgatgagctggtggtgaagagc
ccgcgcagctataactcgcagctgggcgtgccgctgagcgtgtggcagctgcagccaaac
cacaccctggctatttttgaggcgggcatttcgcagccaggggaaatggagaggctgcaa
caagtgattcagccgaccctcggtgtctttaccaacgttggcagcgcccacgacgaaggc
tttgcctcccgcgagcaaaaaatagcagagaagctgaagctgttccagggcgtggagctg
ctgttttactgcgccgactatgagctgctgcatcaggcggtacaggcacagggtataaag
tcctttacctggagccgccatcagccggaggctaacctgtttatcaacgccacgaccact
gccgggcaaaaaacaattgtggtgtacacgtatcagggcgagaagcagcggctggccatt
ccgtttaccgatgaggcctcggtagaaaacgcgctgcactgcctggctctgctgctgtac
cgccgcctgcctctttccgaggtgcaggaccgcctggaccgcctgcacccggtggcgatg
cgcctggaaatgaaggaggccattaacggctgctacctgatcgacgatacctacaacaac
gacctggcaggcctcgccatcgcgctggacctgcaggcaagccagccgcagcgggggcgg
cgcacgcttattctgtcggatgtgctggagtcggggttgccggaggagcagctttacgag
aaggtggcagggctggcacaggcacacaaggtgcagcgcctgatcggcatcggccccact
atcagcaagtacgcgcacctgttcccgcagggcagcttttatacttccaccgctgatttt
ttgcaggctttcgatgcaagctctttccggggcgagctgattttggtgaaaggcgcccgt
gtgtttggctttgagaagatcgtgcaggcgtttcagcagaaggtgcacggcacggtgctg
gaggtaaacctggatgcgctggtgcacaacctgaactactaccgctccagagttgccccg
gctactaagctgatggtgatggtaaaggcgttcgcctacggcagcggcagctttgaggtg
gccaacctgctgcagtttcaccgggtggactatctggctgtcgcctacgttgacgaaggc
gtggccctgcgcgaaaacggtatcacactgcctattatggtgatgaacccctcgcaggac
agcttcgcaaagctgcggcagtacaacctggagcccgagatttactcggtagagcagctg
caggactttgtttcctcgctggagccggaggcaacgtataaaatccacctgaagctggat
acgggcatgcaccgcctcggatttgtgcccgaggactttgaggcgctttttgagctgctg
caccgttatccgcaggtgcaggtggccagcacgttcagccaccttgccggtgccgacgag
gccgtccacaacgatttctcgcagctgcaggtttcccgtttcagaagtatggcggcggcc
gtggaggagcggctcaagtacaaggtgatcaagcatatcctgaactctgccggtattgtg
cgctttccggagcaccagctggacatggtgcggctgggcattggcctgtacggggtagaa
gccacaggctcggagcaggaggcgctgcggccggtaagcaccctgaagacgactgtatcg
caggtgaaaagtataaagcagggcgaaacagtcggctacagccgcaaaggcatcgccagc
tccgacagaaccacggccaccattgccattggctatgccgacggctacgaccgccgcttc
agtaacggggtggggcaggtgctcatcaacggccaccgctgcccgctcatcggcaacgtg
tgcatggatatgtgcatggtagacgtaaccggtgttgccgtaaaagccggcgatgtagcc
attgtgtttgggccgcagctaaccctggtagagctggcccagagcatcggcaccatcccc
tacgagctgctcaccaatgtcagcacgcgggtgaagcgggtgttttatgccgagtaa

DBGET integrated database retrieval system