KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_00800Help
Entry
TIIST44_00800     CDS       T01972                                 

Definition
(GenBank) sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00511  Other glycan degradation
pad00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TIIST44_00800
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TIIST44_00800
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TIIST44_00800
Bacterial toxins [BR:pad02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TIIST44_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AER04689
LinkDB All DBs
Position
complement(155537..157045)
Genome map
AA seq 502 aa AA seqDB search
MTLTTKLSALAIAGIMAVIGAPMVTQSAMASGRAPAPDAATTQPKLVTGDITSTDQSGTH
LFFGKNIVRNAKGAIMKVDRTWPAAVPAPLPDVRADSSTRMLLGPVVDLAVNEHPAGVFY
RIPALATASNGDLLASYDLRPGSAADAPNPNSIVQRRSRDNGRTRGPQTVIHAGTLGRRK
VGYSDPSYLVDPATGHILNFHVKSYDRGFATSEVGTDPDDRHVLHAEVSTSTDNGHTWTY
RDITREITPDPTTRTRFVASGQGIALLHGPHAGRLIAQMTVRNSVGQQAQSIYSDDHGIT
WHAGNPVGRMMDENKVVELSDGTLMLNSRDAARSGRRKVAYSHDGGLTWGPVKLVDDLID
PTNNAQIIRAYPNARAGSAKARILLFTNARNATERVNGTLSVSCDDGRTWVSHQTYMPGE
VGYTTAAVQSDGALGVLWERDGIRYSTIPMGWLNSVCPVAPSGRPTSGEPTSGTSLPLTA
TPSGSLHGGASSRPTSLPHTGD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaccacgaaactgagcgcgttggccattgccggaatcatggccgtcatcggg
gctcccatggtgacgcagtcagctatggcatcaggcagggctccggccccagatgcggcc
accacccagccgaagctcgtcacgggtgatatcaccagcaccgatcagtcgggcactcat
ctcttcttcggtaagaatatcgtccggaacgccaagggagccattatgaaagtcgaccgg
acatggcccgcagcagtgccggcacctctgccggatgttcgtgctgattcgagcacacgg
atgctccttggccccgtcgtggatttggctgtcaatgagcatccggcaggtgttttttac
cgaatcccagcccttgcgaccgcttcgaacggcgatttgctggcctcctacgatctgcgt
ccggggagcgccgccgatgcgcctaaccccaattccatcgtgcagcgccgctctcgcgac
aacggtaggacgcggggtccgcaaaccgtcatccatgccgggaccctgggtcgcaggaag
gtgggatactccgatccttcctatctcgtcgatccagccacgggccacatcctcaatttt
cacgtgaagtcctacgacagaggattcgccacatcggaggtgggcacggacccggatgat
cgtcatgttctgcacgccgaggtctctacatcgaccgacaatggacacacttggacctat
cgagacatcacgcgcgagatcaccccggatcccaccactcggacacgattcgtggcatca
gggcagggcatagcgttgctccacggcccccacgctggacgtctcattgcccagatgacg
gtgcgcaacagtgtcggccaacaggcccagtcgatctattccgatgatcacggcatcacc
tggcatgctggcaacccggtgggccgaatgatggacgagaacaaggtggtggaactgtcc
gacggtaccctcatgctcaattccagggacgcagcccgttccggtcggcgcaaagtggcc
tattcccatgacggtggcttgacctgggggccggtgaagctggtcgacgacctcatcgac
cccaccaacaacgcccagatcattcgggcttaccccaatgcccgggccgggtcggcgaaa
gccaggatcctgttattcacgaatgcccgcaatgccacggaacgggtaaacggtaccctc
tcggtctcctgcgatgacggacggacatgggtcagtcatcagacctacatgcccggggaa
gtcggatacaccacggcagcggtgcagtccgacggggcgttgggcgttctgtgggagcgc
gacggtattcggtactccaccattccgatggggtggttgaattccgtgtgcccggtggct
ccttccgggaggccgacttctggagagccaacttctggcacatctctcccgcttactgcg
accccctccggttctcttcacggaggtgcctcgtcgcgtcccactagtttgccgcacaca
ggagactga

DBGET integrated database retrieval system