KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_04515
Entry
TIIST44_04515     CDS       T01972                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00620  Pyruvate metabolism
pad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TIIST44_04515
Enzymes [BR:pad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     TIIST44_04515
SSDB
Other DBs
NCBI-ProteinID: AER05408
LinkDB
Position
973354..976755
AA seq 1133 aa
MAGTIGSMVTQAHMDSVNLRLALNGLPLPTAARASYIDVVAPVLARQRELRRELPELLCP
ADRRIQAFIDRYLGEDSSVHPRLPDTTLTLDEPGLARALSLPVDGDDFSSDLVSSYRVAN
GVLHNPRNDRRTTAGVFHVAEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTST
QPVDRQAHTWVSLLLRPLVVPEVPGFVSERRMEIRFFAPGGLVSNLDFVEGIFGNSGDPL
LPVNDSALAPSGWTGHSGCIILAPHLNLIRKVDLGLPHVDQATDRQRRDGMCWSDESELY
NEGKPFKLCARDESGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYIS
HNEGQEYATPVCDQTVSDVVMANPDHFEMLSDGQARVLDIDDVVMVPGGAKFSLRDGTVS
WDNGDHSIRMRADTEYISPAGYRIHMVHNDADDQWYLEGTYGDSTTLHKCCTVSGGGKSE
ISKAISDTFLWGNAYSPDFEADMDAVDDILHRDYSTRFADPKLNGIDHRPVLSTERSVGS
VIKLLTPSSDFTDWYNDWINSIPAFRKELVFTIKRYYKPEWGDDWRSHFSVAPTNGRHGN
MVRLDGQKVLVSMARVGFQPDGSWRLFTLRHDYAPAVKVQTEDDMTASIVTSPGVVTGPE
GLSRKVVANCEALLFQRPDDAICRGYDTQTERDMSGRDLFISNYQPLTREDVRAMRDDVV
AFSKFTPPMRTFLSNFADSDPSEQPKFVVSSANPRLIDGVRSRNPRYLQVRPDIAKPRET
AIANLASHLYHGLPIDEPLPLPVDVVAAGRRNNPPEGKIPALCAYNPLHYMELPELFMEF
ISSMTGKSPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPKV
EVAHDISLLVPEIFCRMSPAERDAKTLIEGGYLEKLEDYDKDGELILASRLGYRMTEKFM
RTYFGRIFLHPDTVFTPEMLRPELQDADIFADSVRTISTTHARVAKAYFDDGTVSLAVPP
IRALLEIMVNGVCSEGWTLDDPELREMFTRESVLASDWYAERIDAKQAEAVRRAERGIAH
LEQFMADPRNASACEEIDVQARLDQVRKFHDRAVTAEYRQQLVGTLGRQVNFR
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcaggcacaattggttctatggtcactcaagctcacatggattccgtgaatctaaga
ctggcgctcaacggtctgccactgccgacggctgcgcgcgcttcctacattgacgttgtc
gccccagtcttggcccggcagcgcgagctgaggagggaactccccgagctcctctgcccg
gccgaccgccgtattcaggcattcatcgaccgctacctgggcgaggactcttccgtccac
ccccgactgcctgacaccaccttgaccctcgacgagcccggcctcgcacgggccctctcg
ctacccgtcgacggcgacgatttcagttccgaccttgtctcgagctaccgagtggccaac
ggcgtcctacacaatccccgcaatgaccgtcgcaccactgctggtgtattccacgtcgcc
gagggcggactggcaatccccgacgacaagaaggccgtgccgatcgacgtcttcgctcgt
ctgctcgacctcgccttccaggccccgcccgagcacaccctgctgccttacacttctacc
caaccggtcgaccgccaggcccacacctgggtttccttgttgctgaggcccctggtggtg
cccgaagtgcccggtttcgtctccgagcgccgcatggagattcggttcttcgcccccggc
gggctggtctccaacctggacttcgtggaggggatctttggcaacagtggcgatcccctc
ctgcccgtgaacgactcggccctcgccccgtcaggttggactggccacagcggctgcatc
atcctcgccccgcatctcaacctcatccgcaaggtagacctcggtctgccccatgtcgac
caggcaaccgaccgtcagcgtcgcgacgggatgtgctggtctgacgagtctgagctctac
aacgagggcaagccgttcaagctgtgtgcccgtgacgagtccggggtcatcctcactatc
gtcgccgacaactacttcggctattgcaagaaggaggttaagacccagatctcctactca
gctaacttgttcgggctggccgaggaggagcattccggcggcgcccgcgcctacatctcc
cacaacgagggccaggaatacgccaccccagtctgcgaccagacggtttccgacgtcgtc
atggccaatccggaccacttcgagatgcttagcgacggccaggcccgggtactcgatatc
gacgacgtcgtcatggtgccaggtggggccaagttcagtctgcgtgacggcactgtcagc
tgggataacggtgaccactcgatccgaatgcgcgctgacaccgagtacatctcccccgcc
ggttaccggattcacatggtccacaacgatgccgacgaccagtggtacctcgagggcacc
tacggcgattcgacgaccctgcataagtgctgcacggtatccggtggtggaaagtcggag
atctccaaggccatatcggacaccttcctgtggggcaatgcctactctccggatttcgaa
gccgacatggatgccgtcgatgacatcttgcatcgggactactcgacgcggttcgccgat
cccaagcttaacggcatcgaccatcgtccggtcctctcgacggagcgttcggtgggttcg
gtcatcaagctcctcaccccatcctcggacttcaccgactggtacaacgattggatcaac
tcgattccggccttccgcaaggagctggtcttcaccatcaagcgctactacaagccggaa
tggggtgatgactggcgctcccacttcagcgtcgcccccacgaatggtcgccacggcaac
atggtccgtctcgacggccagaaggtgctggtgagtatggcgcgcgtgggattccagccc
gacggttcgtggcggctgttcaccctgcgccacgactacgctccggccgtcaaggtgcaa
accgaggacgacatgacggcgtcaatcgtcacatctccgggcgtagtcaccggccctgaa
ggcctgtcgcgcaaagtcgtcgccaactgcgaagcgttgctcttccagcgccctgacgac
gccatttgccgtgggtacgacacccagaccgaacgtgatatgagcgggagggacttgttc
atctcgaactaccagccgctaacccgcgaggacgtcagggcaatgcgtgacgacgtggtg
gccttctcgaagttcaccccaccgatgcgcaccttcctgtcgaacttcgccgattccgat
ccttctgaacagccaaaattcgtcgtctccagcgccaatcctcgtcttatcgacggggtg
cgttcgcgcaacccgcgctacttgcaggtgcgtccagacatcgccaagccgcgcgaaacc
gcaatcgccaatcttgccagccacctgtatcacgggctgccgatcgacgaaccgctgcct
ctgccggtcgacgtggtcgccgctgggcgtcgcaacaatccacccgagggcaaaatcccg
gccttgtgcgcgtacaacccgctgcactacatggagctgccggaattattcatggagttc
atctcctcgatgactggtaagagtccttcgacgacgggagccggttcggagggagccctg
acgaaggcaccgttcaacgccttgccagcggtcttcgacctcaactcgtccttcctgtcc
ttcgtgctatcggggtacgacggttggttatcctcggctggattcatcggcccgaaggtt
gaggtcgcccacgacatttccctgctcgtcccggaaatcttctgccggatgtccccggct
gagagggatgccaagaccctcatcgagggtggctatctggagaagctggaagattacgat
aaagacggcgaactcattctcgcctcccgtctgggctaccgcatgacggaaaagttcatg
cgcacctacttcgggcgtatcttcttgcaccccgacaccgtcttcacccctgagatgctg
cgtccggagctgcaggacgccgacatcttcgctgactcggtgcgaacgatctcgaccact
cacgctcgagtggccaaggcctatttcgacgacgggacggtctcgctggcggtaccgccc
atccgggctctgctggaaatcatggtcaacggagtttgctcggagggttggactctcgac
gatcccgagttgcgggagatgttcactcgcgagtcagtacttgcctccgattggtacgcc
gagcgtatcgacgccaagcaggccgaagccgtacggcgcgccgagcgaggaatcgcccac
cttgagcagttcatggctgatccgcgtaacgcgtccgcctgcgaggagattgacgtccag
gcccgtctggatcaagtccgcaagttccacgatcgcgccgtgacggctgagtaccgccaa
cagttggtgggcactcttggtcggcaggtcaacttccgctga

DBGET integrated database retrieval system