KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06295Help
Entry
TIIST44_06295     CDS       T01972                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00330  Arginine and proline metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01130  Biosynthesis of antibiotics
pad01230  Biosynthesis of amino acids
Module
pad_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TIIST44_06295
Enzymes [BR:pad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     TIIST44_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA PDH NAD_Gly3P_dh_N NAD_binding_2 3HCDH_N Shikimate_DH CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AER05742
LinkDB All DBs
Position
1363477..1364268
Genome map
AA seq 263 aa AA seqDB search
MSGKIAVLGCGTMAGALVGGLIDAGQIKAEDVVATARSASHRDEIANTLGVTTSGDNTTA
VRDADLVILGVKPYAAVDVLEEVSGALKADAVVVSIAAGVTTEKLLMAWQGKIVRVMPNT
PVRVGKGAFIVSSAPGSEDAAKKVGDLLESVGVVVTVPEELHNAATAVSGSGPAYVFLVA
EAMIDAAVALGVPRDQASQLTVATLAGSAELLAGGEHPAVLRSEVTSPGGTTAAAVAALE
AGGVRSAFADAMTACRDRAAGLS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaagattgccgtcctgggctgtggaacgatggctggggcgcttgttggtgga
ctcattgacgctggacaaattaaggctgaggacgtcgtggcgaccgcgcgatcggcgtcc
catcgcgacgaaatcgccaacactttgggtgtgaccacgagcggtgacaacaccacagct
gtacgggacgccgacctcgtcatcctcggcgtcaagccttacgcggccgttgacgtgctg
gaagaagtctcgggcgctctgaaagctgatgcggtcgttgtctccatcgccgccggtgtc
actactgagaagttgctcatggcatggcagggaaagatcgtccgtgttatgccaaacacc
ccagttcgggtgggcaaaggggcgttcattgtgagttccgctcccggctccgaggacgcg
gctaaaaaggtgggtgacctgctcgaatcggtaggagtcgtcgtcactgtgcccgaggag
ctgcataatgctgccacagccgtgtcgggatcgggtccggcgtacgttttcttggtagca
gaggccatgatcgatgctgccgttgcgctgggtgtgccgcgcgaccaggctagccaactt
accgtagcgacgttagccggttcggctgagttgttggcaggaggcgagcaccctgcggtc
ctgcgatccgaggtgacgagcccgggtggtaccactgcggctgccgtagccgcattggag
gccggaggtgtgcgctccgctttcgccgatgcgatgacggcatgtcgggaccgcgccgct
ggcctgtcctga

DBGET integrated database retrieval system