KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_10245Help
Entry
TIIST44_10245     CDS       T01972                                 

Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00040  Pentose and glucuronate interconversions
pad00053  Ascorbate and aldarate metabolism
pad01100  Metabolic pathways
pad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TIIST44_10245
   00053 Ascorbate and aldarate metabolism
    TIIST44_10245
Enzymes [BR:pad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     TIIST44_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DBP10CT
Motif
Other DBs
NCBI-ProteinID: AER06504
LinkDB All DBs
Position
complement(2172270..2173157)
Genome map
AA seq 295 aa AA seqDB search
MTESLTDGVTLGIYEKALVGNPLATDDDWRRFLIQVPEAGFSFVDLSVDESEERTARLQW
DQRRRRMVRHCAEAAETAIGGVCLSVHRRIGPGSADPAVRQRAREVMAEGLQLCHDLGAP
VLQVAGYYCYYEQMNDHAEQWYTDLLLDAVPMAARLGVVMGIENVDGTDVTSIRKAMEFV
KLADSPYLQVYPDLGNIAEQQLDAVTELKAGRGHMVAIHVKDVRPGEPRRVPMGEGTVDW
DESFAVLAEQGWRGRMMIEMWNDDAPDSNARSASACQFIEEHLRTAGIPVRRALS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcgctgaccgacggggtgaccctcggcatctatgagaaagccctcgtcggc
aaccccttggctaccgacgacgactggcgacgcttcctaatccaggtacccgaggcagga
ttcagttttgtcgacctgtccgtcgatgagtccgaagagaggacagcacggctccaatgg
gaccagcgccggcgtcgcatggtgcgccattgcgctgaggccgcagaaaccgctatcggt
ggtgtctgcttatcggtacatcggcgtattggccctggtagtgccgacccagccgtgcgc
cagcgagctcgggaggtgatggccgaaggattgcagctgtgccacgaccttggcgctccc
gtgcttcaggtcgcggggtactactgctactacgagcagatgaatgaccatgccgagcag
tggtataccgacctcctgctcgacgccgtcccgatggctgcacggctgggggttgtcatg
ggcatcgagaatgttgacggcaccgacgtcacttctatccgtaaggcgatggagttcgtc
aagcttgccgactcgccctacctgcaggtgtacccagaccttggcaacattgccgagcaa
cagcttgacgccgtgaccgaactcaaggccgggcggggccacatggtcgcgatccacgtc
aaagatgttcggccgggtgagcctcgtcgggtaccaatgggggagggaaccgtcgactgg
gacgagtccttcgctgtccttgctgagcagggttggcgcggccgaatgatgatcgagatg
tggaacgacgacgctcccgattccaacgcgcgcagtgcgtcagcatgccagttcatagag
gagcatcttaggaccgctggaatcccggttcgccgcgccctctcttga

DBGET integrated database retrieval system