KEGG   Candidatus Pseudomonas adelgestsugas (Adelges tsugae): C3B55_00086Help
Entry
C3B55_00086       CDS       T05857                                 

Gene name
proC
Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pade  Candidatus Pseudomonas adelgestsugas (Adelges tsugae)
Pathway
pade00330  Arginine and proline metabolism
pade01100  Metabolic pathways
pade01110  Biosynthesis of secondary metabolites
pade01130  Biosynthesis of antibiotics
pade01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pade00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    C3B55_00086 (proC)
Enzymes [BR:pade01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     C3B55_00086 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N NAD_binding_2 PDH Shikimate_DH ApbA GFO_IDH_MocA CoA_binding_2 IlvN NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: QAX81457
UniProt: A0A481QKU9
LinkDB All DBs
Position
complement(153049..153843)
Genome map
AA seq 264 aa AA seqDB search
MSNTRIAFIGAGNMAASLIGGLRDKSLEIIQISARESAKYNINTFADITEKISEVDIIVL
AVKPQAMQAICKKLRPNLQPHQLVVSIAASITCASMKTWLGAAQPIVRCMPNTPALLHKG
VSGLYATPEVVAKQRNQAQELLSAVGVVVWLKQEQQLDAVTALSGSGPAYFFLLIEAMIT
TGVKLGLPYEVTKLLVEQTALGAASMVIDSDVDTTELRRRVTSPGGTTQAALELLQAGNF
EILVEKALIAAAHRSAELAKQLGK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacgcgcattgcctttataggtgctggtaacatggcagctagtttgatcggt
ggcttacgggataaaagcttagagatcatacaaattagcgcccgtgaaagtgctaagtac
aatatcaacacatttgccgatatcactgaaaagatcagcgaagttgacataattgtgctg
gcggtaaaaccgcaagccatgcaggccatatgcaaaaaactgcgccccaacctacaacca
catcaactggtagtatcaattgctgctagtatcacttgtgctagcatgaaaacctggctc
ggtgctgcacaaccgatagtacgctgcatgcctaatacgccagcgctgctacacaaaggc
gtaagcggtttatatgctacccctgaagtcgtagctaaacagcgaaatcaggctcaagag
ttgttgtccgccgtaggcgtcgtggtttggctgaagcaggagcaacaactagacgcagtt
accgctttatcaggtagcggtccggcatattttttcctgttaatcgaagcgatgatcact
actggtgtaaaactaggcctgccctacgaagtaactaagctattggttgaacaaactgct
ctaggcgctgcaagcatggtcatcgatagtgatgtagatactactgaattacgacgtcgg
gtaacttcacctggtggcactacgcaagctgctctagaattgttacaggctggaaatttt
gagatcttagtggaaaaagcactgattgccgcagcacatcgttcggctgaattagctaag
caactcggcaaatag

DBGET integrated database retrieval system