KEGG   Candidatus Pseudomonas adelgestsugas (Adelges tsugae): C3B55_00662Help
Entry
C3B55_00662       CDS       T05857                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pade  Candidatus Pseudomonas adelgestsugas (Adelges tsugae)
Pathway
pade00020  Citrate cycle (TCA cycle)
pade00190  Oxidative phosphorylation
pade00650  Butanoate metabolism
pade01100  Metabolic pathways
pade01110  Biosynthesis of secondary metabolites
pade01120  Microbial metabolism in diverse environments
pade01130  Biosynthesis of antibiotics
pade01200  Carbon metabolism
Module
pade_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pade00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3B55_00662 (sdhB)
   00650 Butanoate metabolism
    C3B55_00662 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C3B55_00662 (sdhB)
Enzymes [BR:pade01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C3B55_00662 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     C3B55_00662 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: QAX81987
UniProt: A0A481QMA3
LinkDB All DBs
Position
complement(1141768..1142484)
Genome map
AA seq 238 aa AA seqDB search
MVTSMLSVSVYRYNPDQESAPFMQEFQVDTCGKDLMVLDVLAFIKEQDESFSYRRSCREG
VCGSDGMNINGKNGLACIMPLSTVVKRNKLILRPLPSLPVIRDLVVDMSIFYKQYEKVKP
FLQNDTPTPAIERLQLPEERKKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQSYR
FLADSRDTKTSERLASLDDPFSVFRCRGIMNCVHVCPKGLNPTKAIGQIRNMLLQSGV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggtgacctctatgttgtcagttagtgtgtatcgctacaaccctgatcaggagtctgcg
ccgtttatgcaggaattccaggtcgatacctgtggtaaagatctgatggtgctagatgtg
ttggcgttcataaaagagcaagatgagagcttctcatatcgccgttcttgtcgtgagggt
gtttgtggctcagacggcatgaatattaatggtaaaaacggcctggcatgtatcatgccg
ctttccactgttgtgaaaagaaacaagttaattttgcgtcctttgcctagtttaccggtt
atccgtgatctggttgttgatatgagcatcttttacaagcaatacgaaaaagttaagccg
ttcctgcagaatgacacaccaactccggctattgaacgcctgcaattacctgaagagcgt
aaaaagctcgacggtttatacgaatgcattctatgcgcttgctgctctacctcgtgccca
tcattttggtggaacccagacaaatttttgggtccagcagccctactacaaagctaccgc
ttcctggcagacagtcgtgacactaagacttctgagcgtttggcatcacttgatgacccg
tttagcgtatttcgctgccgcgggatcatgaactgtgttcatgtttgtcctaaaggccta
aacccaactaaggccattggccaaatccgtaatatgttgttgcaaagcggcgtgtaa

DBGET integrated database retrieval system