KEGG   Candidatus Pseudomonas adelgestsugas (Adelges tsugae): C3B55_00663Help
Entry
C3B55_00663       CDS       T05857                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pade  Candidatus Pseudomonas adelgestsugas (Adelges tsugae)
Pathway
pade00020  Citrate cycle (TCA cycle)
pade00190  Oxidative phosphorylation
pade00650  Butanoate metabolism
pade01100  Metabolic pathways
pade01110  Biosynthesis of secondary metabolites
pade01120  Microbial metabolism in diverse environments
pade01130  Biosynthesis of antibiotics
pade01200  Carbon metabolism
Module
pade_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pade00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3B55_00663 (sdhA)
   00650 Butanoate metabolism
    C3B55_00663 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C3B55_00663 (sdhA)
Enzymes [BR:pade01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C3B55_00663 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     C3B55_00663 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: QAX81988
UniProt: A0A481QMD3
LinkDB All DBs
Position
complement(1142484..1144256)
Genome map
AA seq 590 aa AA seqDB search
MATIPTLSFAAVIIGGGGAGMCTSLQLARGSHKIAVITKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPATVFELDHMGLPFSRTEEGRIYQRP
FGGQSKNYGQGGQAARTCAASDRTGHALLHTLYQANLKAGTTFLNEYYAVDLVKNDNGVF
VGVIAICIENGEITYIRAHATVLATGGAGRIYASTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKYGERFMERYAPNAKDLASRDVVARSMVKEI
IAGNGCGPNGDYVLLKLDHLGDGVLRSRLPGICELSKTFAHVDIMVAPVPVVPTCHYMMG
GIPTNIYGQVITQNAEGMDEIIHGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRSAGLY
LKKVLTDSIEYDAATNANIEVALARLNALNARVDGEDVATLRRELQNSMQNYFGVFRTGE
YMQKGIVKLDNLRKRITNVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFKDRDDENWLCHTLYFSSNKRVTKRAVNVSPKTVPMFKPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccaccattccaactctttctttcgccgctgtcattattggtggtggtggtgctggc
atgtgcacctctttgcaactagctaggggtagtcataagattgccgtgatcaccaaagta
ttcccgacgcgttcccacaccgtatcagcacagggtggcattacttgcgccattgcgtct
gccgacccaaacgatgattggcgctggcatatgtatgataccgttaagggttccgattat
atcggtgaccaggatgctatcgagtatatgtgtcaagaaggcccagccacagtattcgaa
ttagatcatatgggtctaccattttcgcgtaccgaagaaggtcgcatctatcagcgtcca
tttggtggtcagtcgaagaattacggccaaggtggccaggctgcccgtacctgcgctgcg
tcagaccgtactggtcatgcattgctgcataccctttatcaagccaacctaaaagctggt
actacgtttttgaacgagtactatgcagtagatctagtcaagaacgacaatggtgtgttc
gttggtgtaattgctatttgtattgaaaatggcgaaattacttatatccgcgcccatgct
actgttctagcaactggtggtgccgggcgtatctacgcgtctactactaatgctttgatt
aatactggtgacggtattggtatggctcttcgtgcaggtgttccggtacaagatattgaa
atgtggcagttccacccgactggtatcgctggcgctggtgtgctagttactgaaggttgc
cgtggtgaaggtggttatctcattaacaaatatggcgagcgcttcatggagcgttatgcc
ccaaatgccaaagaccttgctagtcgtgacgttgttgcccgttcaatggttaaggagatt
attgctggcaacggctgtggccctaacggcgattatgtactacttaagttagatcatctt
ggtgatggggtcctgcgtagtcgactgccaggtatctgtgagctttctaaaacctttgct
catgttgatattatggtcgctccggttccagttgttcctacttgtcactatatgatgggc
ggtataccaacaaatatttatggtcaggtgatcactcagaatgccgaaggcatggatgaa
atcatccatggcctgttcgctgtaggtgaagttgcgtgcgtatcggtacacggtgcaaac
cgtctaggcggcaattctctactcgatctagtcgtatttggtcgttctgctggcttgtac
ttgaaaaaagtcctcactgacagcatcgaatacgatgccgctaccaatgctaatatcgaa
gttgccctagcacgcttaaacgctctaaacgcgcgtgttgatggcgaagacgtggccacc
ctgcgtcgtgagttacaaaacagtatgcagaattattttggtgtattccgtactggcgaa
tatatgcagaaaggcatcgttaagctagataacttacgtaagcgtataactaatgttaaa
atcaatgataaaagtcaggcgttcaatactgctcgaattgaagcccttgagttgcaaaat
ttgttagaagtagctgaagctactgctatcgccgcagaggttcgcaaagaatctcgtggc
gctcatgctcgtgaagattttaaagatcgagacgatgagaactggttatgccacaccctg
tacttctcgagtaataagcgcgtaaccaagcgtgcagtgaacgtctcacctaaaacagtt
ccgatgtttaaaccgaaggttaggacttactaa

DBGET integrated database retrieval system