KEGG   Candidatus Pseudomonas adelgestsugas (Adelges tsugae): C3B55_00716Help
Entry
C3B55_00716       CDS       T05857                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pade  Candidatus Pseudomonas adelgestsugas (Adelges tsugae)
Pathway
pade00071  Fatty acid degradation
pade00280  Valine, leucine and isoleucine degradation
pade00281  Geraniol degradation
pade00310  Lysine degradation
pade00362  Benzoate degradation
pade00380  Tryptophan metabolism
pade00410  beta-Alanine metabolism
pade00640  Propanoate metabolism
pade00650  Butanoate metabolism
pade00903  Limonene and pinene degradation
pade00930  Caprolactam degradation
pade01100  Metabolic pathways
pade01110  Biosynthesis of secondary metabolites
pade01120  Microbial metabolism in diverse environments
pade01130  Biosynthesis of antibiotics
pade01200  Carbon metabolism
pade01212  Fatty acid metabolism
Module
pade_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pade00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C3B55_00716 (fadB)
   00650 Butanoate metabolism
    C3B55_00716 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C3B55_00716 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C3B55_00716 (fadB)
   00310 Lysine degradation
    C3B55_00716 (fadB)
   00380 Tryptophan metabolism
    C3B55_00716 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C3B55_00716 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C3B55_00716 (fadB)
   00281 Geraniol degradation
    C3B55_00716 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C3B55_00716 (fadB)
   00930 Caprolactam degradation
    C3B55_00716 (fadB)
Enzymes [BR:pade01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     C3B55_00716 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C3B55_00716 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     C3B55_00716 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     C3B55_00716 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: QAX82038
UniProt: A0A481QMH7
LinkDB All DBs
Position
complement(1241066..1243222)
Genome map
AA seq 718 aa AA seqDB search
MIYEGKAITVKTLESGVVELKFDLKGESVNKFNSLTINELRQAIDIIKADASVRGVIVSS
GKDVFVVGADITAFTSNFKLPYAELKADYLYANKIFSDFEDLKMPTVAAINGTALGGGLE
ICLAADFRVMSATAKIGLPEVKLGIHPGFGGTVRLPRLIGADNAMAWITTGKENSAIDAL
KMGAVDSVVVPDKLANAALNLIKSAINGEFDYKAKRQPKLEKLKLNAIEQMMSFETTKGF
IVGKIGTNYPAPIEVIKTIQKSANCGRDKALEVESAGFIKLSKTFVAQSLIGLFLNDQTL
KKKIKVYNKTAKDVNLAAILGAGIMGGGIAYQSASKGTPILIKDINQRSIEHSLAVASKL
LVNCVNQGHMTASKMAEVLNNIRPTLSYGDFGHVDLVVEAIVEHLQVKQDVLIEVEAQVK
DDTILASNTSTISISLLAKALRRPENFVGMHFFNPVHMMPLVEVIRGEKSSKLAIATTVA
YAKKMGKSPIVVNDCPGFLVNRILFSYFGGFAKLVSAGVDFVRIDSIMEKFGWPMGPAYL
MDVVGIDTCYHSQHIMAKSLSSRTKDGRRSAIDVLYEAKRLGQKNSKGFYAYEADKKNKQ
KKVSDLSVYELLATIIYEQCEVSDDNVINWMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPSFRGGALRYIDSIGVAKFVALADQYANLGQLYHPTAKLREMAENGQSFFGSAL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaaactcttgaaagtggtgtagtagaacta
aagtttgacctcaaaggcgaatcagttaataagttcaacagtctgactattaatgaattg
cgtcaggctatagatattattaaagcagatgcttcagtcagaggtgtgattgtgtctagc
ggtaaagacgtgtttgtcgtaggtgctgacatcactgcatttaccagtaactttaagctg
ccatatgcagaacttaaggctgactacctatacgccaataagatttttagcgattttgaa
gacctcaagatgccaactgttgctgctatcaatggtaccgcgttaggcggtggtctagaa
atatgcttagctgcagactttcgtgtcatgtcagccactgctaaaattggcctgcctgaa
gtcaagctgggtatacatccaggtttcggcggcactgtgcgcctgccgcgcttaattggc
gccgataacgcgatggcatggattaccacaggtaaagaaaatagtgctatagacgcacta
aaaatgggtgctgttgactctgtggttgttccagacaaactagccaatgctgcattaaac
ctgattaagagcgctattaacggtgaatttgactataaggccaagcgtcagccgaagctt
gaaaaacttaagcttaacgctattgaacaaatgatgtcgtttgaaactactaaaggtttt
atagtgggcaaaataggtacgaattaccctgcgccaattgaagtaatcaagactatccaa
aaatccgctaattgtggccgcgataaagctttagaagtggaatctgccggcttcatcaaa
ctatcaaaaacctttgttgctcaaagcctaataggtttatttctgaacgaccagacactc
aagaaaaaaatcaaagtttataataaaactgctaaagatgtaaatctggccgctatacta
ggcgctggtattatgggtggcggtattgcttatcagtcggcgtctaaaggtacgcccata
ctgataaaagacatcaatcaacgtagcattgaacacagcctggcagtggcctctaagttg
ttagtgaattgcgttaatcaaggtcatatgactgcttcaaaaatggctgaagtacttaat
aatattcgtcctacgttgtcttatggcgattttggtcatgtagacctagtggtcgaagct
attgttgagcacctacaggtcaagcaagacgtactgatagaagtagaagctcaggtgaag
gatgacactatcttggcttcgaatacctcgactatttctatttcgctactagccaaggct
cttaggcgtccagaaaactttgttggtatgcacttttttaatccggtgcacatgatgccg
ttagtagaagtgattcgtggcgagaagtctagcaaactagctattgcaaccactgttgct
tacgctaaaaaaatgggcaagagcccaattgtggtcaatgactgtccaggttttctagtc
aaccgcatacttttctcgtactttggaggttttgctaagcttgttagtgctggtgtagac
tttgtgcgtatcgatagtatcatggaaaagtttggttggccgatgggcccagcatatctt
atggatgtagtgggcattgatacttgttatcatagccaacacatcatggctaagagcctt
tcaagccgcacaaaagacggccgccgatcggcgatcgacgttctctatgaagctaagcgt
ttaggtcagaagaatagtaagggcttctacgcctacgaagctgataagaaaaataaacaa
aagaaagtatccgatttatctgtgtatgaattacttgcgacaatcatttacgaacagtgt
gaggtatctgatgataatgttattaactggatgatgattcctttatgcttggaaactgtg
cgttgcttagaagacggtattgttgaaacggccgcagaagctgatatgggtctaatatac
ggtatcggtttcccttcatttcgtggtggtgcattacgttatatcgactcgattggtgtg
gctaaattcgttgccctagctgatcaatatgctaatttaggccagctgtaccacccgact
gctaaattgcgtgaaatggctgaaaacggccagagcttttttggttcagcgctttga

DBGET integrated database retrieval system