KEGG   Pygoscelis adeliae (Adelie penguin): 103912519
Entry
103912519         CDS       T06012                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00220  Arginine biosynthesis
padl00330  Arginine and proline metabolism
padl01100  Metabolic pathways
padl04020  Calcium signaling pathway
padl04146  Peroxisome
padl04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103912519 (NOS2)
   00330 Arginine and proline metabolism
    103912519 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103912519 (NOS2)
   04020 Calcium signaling pathway
    103912519 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103912519 (NOS2)
Enzymes [BR:padl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103912519 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400 NAD_binding_6
Other DBs
NCBI-GeneID: 103912519
NCBI-ProteinID: XP_009317081
LinkDB
Position
Unknown
AA seq 1158 aa
MLCPWQFAFKPRAAKHQSSEEKDINNNVEKNRKIHGLENDDAKLHDLSKKRIEMPPIITS
AKASDRRENPPQNGIKASNQISRCPRHVKVRNLENGSSFLDTLHLTAKEVINCRTKACQG
ALMTPKGLVRGTRDRPVLPAELLPQAIDFIKQYYSSFKEPKIEEHLDRLETVTKEIETTG
TYHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIQYATNN
GNIRSAITVFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSIVGDPASVEFTQLCIELGWKP
KYGRFDVVPLVLQANGQDPEIFEFPPEIVLEVPMEHPKYEWFKELDLKWYALPAVANMLL
EVGGLEFTGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLYSFQKQNVTIMDHHSAAESFMKYMQNEYRMRGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPKKKEIKFSILAKAVLFASSLMRQTMATRS
KVTVIYATETGKSETLANNLCSLFNCAFNTKILCMDEYNICDLEKETLLLVVTSTFGNGD
SPNNGKTLKNSLLTLNLLRKKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPIG
EGDELNGQEEAFRTWAVSAFKTACDIFNIRGKNSIQLPEIYTSDESWDPKNYRIVHDSQT
LDLAKALANIHAKNIIPMKLKFRQNLQSLKSSRVTIQVKLSCETNQEVHYLPGEHIGIFP
GNQPELVHGLIAHVRDAPPADQTIRLETCTDGGYWTSDKKIPACTLPEALTYLLDITTPP
SQQLLKKLSQLVTAEGDKQKLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLL
TQLPFLKPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNTIALNEIV
PCFIRSANGFQLPEEPTKPCILIGPGTGIAPFRSFWQQRLYDLETKGIKGGDMTLLFGCR
QPDMDHIYKEETEEMKRKGVLKEVYTAYSRQPGQAKVYVQDILQSKLETKVCNLLHKEEG
HLYVCGDVRMAKDVAQTLKRVLAKNLNLNEQQAEEYFFQLKSQKRYHEDIFGAAFPHEVK
RGVRALQPTSPRTNQLMV
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgttgtgcccatggcagtttgcattcaaacctcgtgctgctaagcaccagtcctctgaa
gagaaggatatcaataataacgtggagaaaaataggaagatccacggcttagaaaatgat
gatgccaaattacatgacctgagcaagaagcggatagagatgccacctatcataacttca
gcaaaggccagtgacaggcgagagaaccccccccaaaatggtatcaaagcttcgaaccaa
atatcaagatgtccaagacatgtaaaagtaagaaacttggaaaatggatccagctttctc
gacacactacacctgacagcaaaggaggttatcaactgccggaccaaagcctgccaaggg
gcactcatgaccccaaagggcctggtgagaggtactagagacaggccagtcctaccagca
gagcttttacctcaggcaatagactttatcaagcagtactacagttcatttaaagagcca
aaaatagaagaacacctggaccgactggaaacagtgaccaaggagatagaaacaacagga
acctaccatctgacaaaggatgaactgatctttgctgccaaacaggcctggaggaatgca
cctaggtgtattgggagaattcagtggtccaatctacaggtatttgatgcacgtgattgt
aaaacagcaaaggaaatgtttgaacatatctgtcgtcatattcagtatgccacaaacaat
ggaaatataagatcagccatcactgtgttcccccagaggactgatgggaaacacgatttc
cgtgtttggaacagccagctcatccgatatgctggatatcaaatgccagatgggtctatc
gtaggagaccctgccagtgtggagttcacacagttgtgcattgagcttgggtggaagcca
aaatatggccgctttgatgtagttccacttgttctccaagcgaacggccaagacccagaa
atatttgaattcccgccagaaattgtccttgaagtgccaatggagcatccaaagtatgaa
tggtttaaggagttagatctgaagtggtatgcgctgcctgctgttgccaacatgcttctt
gaggtgggaggcctggaatttactgggtgtcctttcaatggctggtacatggggacagag
atcggagtgcgagacttctgtgatgtacagcgatacaacatcctgaaggaggtaggaaga
agaatgggactggaaacaaacaaactttcatcgttatggaaagaccgagctgttgtagag
ataaatgtggctgtgctttatagcttccaaaaacaaaatgtgactatcatggatcaccac
tcagctgctgagtccttcatgaaatacatgcagaatgagtaccgtatgcgaggaggctgc
ccggctgactgggtgtggattgtacctcctatgtcagggagcataacccctgtgttccac
caggagatgttgaactatgtcctcactcccttctattactaccaggtggatgcatggaaa
acacatgtctggcatgatgagacccggaggccaaagaaaaaagaaataaaatttagcatc
ttggcaaaagctgtactctttgcatcttcactcatgcgacaaacaatggcaaccaggtcc
aaggtcactgtaatctatgcaacagagactgggaaatctgaaacgctggccaacaatctg
tgcagcttgttcaattgtgccttcaacactaagattctgtgcatggatgaatacaacatc
tgtgacctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagat
tctccaaataacggaaagaccttgaagaactccttgctcaccctgaacttgctgagaaaa
aaaattagatacgctgtgttcggtttggggtccagtatgtacccagagttctgtgccttt
gctcatgccattgaccaaaaactggcccaactaggggcttctcagctcactccaataggt
gaaggagatgaactcaatgggcaagaagaagcctttcgcacatgggcagtcagtgcgttc
aagactgcctgtgacatttttaacatccgtgggaaaaacagcattcagttgcctgagata
tatacctctgatgaaagctgggatcctaagaattacaggatagtgcatgactctcaaacc
ctggacttggctaaagcacttgcaaacattcatgccaagaatataattcccatgaagctg
aaattcagacagaatcttcaaagtttaaaatccagtcgtgttacgattcaagttaagctt
tcctgtgagactaatcaggaagtgcactacctgcccggagaacatatcgggattttccca
ggcaaccagccagaattagtccatggcctcattgcacatgtcagggatgcccctccagct
gatcagactatcagacttgaaacctgcactgatggtggctactggacaagtgacaaaaag
attccagcctgcacactccccgaggctttgacatacttgcttgatatcactactccaccc
tcccaacaactgctaaaaaaactctcccagctggtaacagcggaaggagacaaacagaaa
ctggaagttttatgtcagagcacggaagaatacaataaatggaagttttacaacagccca
aacatcctggaggtcctggaggagttcccttctgctgaggtctcaacagctttcttactg
actcagctgccatttctgaaacccaggtactattctgtcagttcctcctgtgacatgaca
cccagagagattcatctgacagttgcagttgtaaactacaggacaagagatggacaaggg
cctttgcaccatggggtttgcagcacatggctgaatacaatagctctcaatgaaatagtc
ccatgctttatacgcagtgctaatggattccagctcccagaggagccaaccaagccatgc
attctgattggcccaggaacaggaattgctcccttcagaagtttctggcagcagcgtctc
tatgacttggaaacaaaagggatcaaaggtggtgacatgacattactgtttggctgccgg
cagccagacatggatcacatctacaaagaagaaactgaggaaatgaagaggaagggagtc
ctgaaagaagtctatacagcttactccagacaacctggccaagctaaagtctatgttcaa
gacattcttcaaagcaagttggagaccaaagtgtgcaacctcttgcataaggaagaagga
catctgtatgtctgtggagacgtacgcatggccaaggatgttgctcagactttgaaaagg
gtgcttgcaaaaaacctgaacctcaatgagcagcaggcagaggagtatttcttccagcta
aagagccaaaagcgataccatgaagatatatttggggctgcattcccacatgaagtcaaa
agaggtgtaagagctttgcaacccaccagtccaagaacgaatcaacttatggtttag

DBGET integrated database retrieval system