KEGG   Pygoscelis adeliae (Adelie penguin): 103912856Help
Entry
103912856         CDS       T06012                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:padl01009]
    103912856 (CHP1)
Protein phosphatases and associated proteins [BR:padl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103912856 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 103912856
NCBI-ProteinID: XP_009317538
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MAEPGAPAPAPPPHAWSQPALGRDPAVPSDRGRTCLVGLRKPGKRLLVRPSLPVAAQERR
WGHGARGPGLAETREPTRLLWYCAGLPLAWGWQQPPAANAAAVSHSQITRLYSRFTSLDK
GENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSK
DQNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTI
QEADQDGDSAISFAEFVKVLEKVDVEQKMSIRFLH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaggcgcccctgcaccagcgcctccacctcacgcctggtcccagccggct
ctgggccgggaccccgctgtccccagcgaccgggggcggacgtgtctcgtaggcctgcgg
aaacctgggaaacgcctcttagttcgcccctcgctgccggtcgccgcgcaggagcggcgc
tgggggcacggcgcccgcggcccggggctggcagaaacccgcgagccaacgcgtctcctt
tggtactgtgccggtctccctctcgcttggggctggcagcagccgccggctgcaaatgca
gctgctgtctcccacagtcaaatcacccgcttgtacagtcgcttcaccagcctagacaaa
ggagaaaatggcactcttagccgtgaagacttccagcggattccagagcttgccatcaat
ccactgggagacagaattatcaatgccttctttccagaaggagaggaccaggtgaatttc
cgtggattcatgaggacactagcccacttccgacccatagaagataacgaaaaaagcaaa
gaccagaatggaccagaaccactgaacagccgaagtaacaagctccactttgcttttcgg
ttatatgatctagataaagatgacaagatttccagggatgagcttcttcaggtattacgg
atgatggttggtgtaaacatttcagatgagcagctgggcagcattgctgacaggacaatc
caggaagctgatcaggatggggatagtgccatctcctttgcagagtttgtaaaggttttg
gagaaggtggatgtagagcagaaaatgagcattcgatttcttcactga

DBGET integrated database retrieval system