KEGG   Pygoscelis adeliae (Adelie penguin): 103912893Help
Entry
103912893         CDS       T06012                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00512  Mucin type O-glycan biosynthesis
padl00514  Other types of O-glycan biosynthesis
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103912893 (WBSCR17)
   00514 Other types of O-glycan biosynthesis
    103912893 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:padl01003]
    103912893 (WBSCR17)
Enzymes [BR:padl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103912893 (WBSCR17)
Glycosyltransferases [BR:padl01003]
 O-Glycan biosynthesis
  Mucin-type
   103912893 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103912893
NCBI-ProteinID: XP_009317577
LinkDB All DBs
Position
Unknown
AA seq 593 aa AA seqDB search
RVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDIHPRAEVANLTARGISSIQDAVLK
RLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGYNSYLS
EKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTPAHLLK
EIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQITGFF
DAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYIS
PPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIKVWLCG
GSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPG
IDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLDQGPQE
NHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLDCEKVK
SSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
agagtcaaagtcctgctggtgttaaacttgatcgcggtggctggcttcgtcctcttcctg
gccaagtgcagacccatcacggccaagagcggcgactccttccatgacatccatcccagg
gcagaagtggccaacttgacagcccgcggcatcagctccatccaggatgcggtgctgaag
agactctccctcctagaagatatagtctacaggcagctgaatggtctgtccaagtcactt
ggtctcattgaaggctatggtggacgtggtaaaggtgggcttccagccaccctgtcccct
gaggaggaggagaaagcgaagggaccacatgagaaatacggctacaactcctacctcagt
gagaaaatttcactggatcgttccataccagattatcgtccaaccaagtgcaaagagctg
aaatatggcaaggacctaccccagatctccatcatcttcatcttcgtgaacgaagcgcta
tcggttatcctgcgatcagtgcacagtgctgttaatcatacgccagctcacctcctgaag
gagattatccttgtggatgacaacagtgatgaagaggaactgaaggcgccgctagaagaa
tacgtcaataaacgatacccaggcctcgtgaaggtggtgcgcaaccagaagagggaaggc
cttatccgagctcgtattgaaggctggaaagctgccactggccagatcactggatttttt
gatgctcatgtggagttcactgccggctgggctgagccggtactttcacggattcaggaa
aatcggagaagggtcattcttccctccatagacaacatcaagcaggacaacttcgaggtg
cagcgttacgagaactctgcccacgggtacagctgggagctgtggtgcatgtacatcagc
ccccccaaggactggtgggatgctggagacccctcgctgcccatcaggacaccagcgatg
atcggttgctcgttcgttgtgcacagaaagttctttggagagattgggcttctcgatcct
gggatggatgtgtacggaggggagaacatagaacttggcatcaaggtgtggctgtgcggt
ggcagcatggaggtcctgccctgctccagggtggctcacatcgagcgcaagaagaagccc
tacaacaacaacattggtttctacaccaagcgcaacgccctgcgggtggctgaggtgtgg
atggacgactacaaatcacacgtctacattgcgtggaacctgccgctggagaacccaggt
attgacattggggatgtttcagagagaaaagcattaaggaagagcttgaagtgtaaaaat
ttccagtggtacctggaccacgtttatccggaaatgagaagatacaacaacaccatcgct
tatggcgagcttcgaaacaacaaggcgaaagacgtctgccttgaccagggcccgcaggag
aaccacacagcaatattgtacccgtgccacggctggggaccacagcttgcacgctacacc
aaggagggattccttcatctcggtgcccttgggaccacgactcttctacccgatacccgc
tgcctggtggataacgtgaaaagccgcttccctcagctccttgattgtgaaaaggtcaag
agcagcctccataagcgctggaatttcatacagaacggtgccatcctgaacaagggaacg
ggacgatgcttggaagtggagaacaggggaatggctggcatcgatctgattcttcgcagc
tgcacaggacaaaggtggacgattaaaaatttcatcaagtaa

DBGET integrated database retrieval system