Pygoscelis adeliae (Adelie penguin): 103913236 Help Entry 103913236         CDS       T06012                                  Name (RefSeq) ADP-ribosylation factor 6-like   KO K07941   ADP-ribosylation factor 6 Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl04144   Endocytosis padl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:padl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103913236  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103913236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:padl04131]     103913236   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:padl04147]     103913236    04031 GTP-binding proteins [BR:padl04031]     103913236 Membrane trafficking [BR:padl04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103913236   Arf GTPases and associated proteins    Arf GTPases     103913236 Exosome [BR:padl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103913236   Exosomal proteins of colorectal cancer cells    103913236 GTP-binding proteins [BR:padl04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     103913236 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc Ras G-alpha Gtr1_RagA SRPRB GTP_EFTU SpoOE-like DUF2754 Motif Other DBs NCBI-GeneID:  103913236 NCBI-ProteinID:  XP_009317986 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search METVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADCDRIHEARQELHRIID DRDMQDAIILVFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATGDGLYEGLMTW LTSNYKS NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggagacggttacttacaaaaacgtcaagttcaacgtgtgggatgtcgggggccaggac aagatccgtcccctctggaggcactactacacgggcacgcaagggttgatctttgtggtg gactgcgccgattgcgaccgcatccacgaggcccgccaggagctccaccgcattatcgat gacagggacatgcaggatgccatcatcctcgtcttcgccaacaagcaggacctgcctgat gccatgaaaccccatgaaatccaggagaaactgggcctgacccgaatcagggataggaat tggtacgtgcagccctcctgtgctacaggggatggactctacgaagggctgatgacatgg ttaacatccaattataaatcctaa

DBGET integrated database retrieval system