KEGG   Pygoscelis adeliae (Adelie penguin): 103914121
Entry
103914121         CDS       T06012                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103914121 (CACNA1E)
   04020 Calcium signaling pathway
    103914121 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:padl04040]
    103914121 (CACNA1E)
Ion channels [BR:padl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103914121 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 103914121
NCBI-ProteinID: XP_009319003
LinkDB
Position
Unknown
AA seq 2245 aa
MARFGEAVAGRLGSGDGGSDQNRSRQGPPAPAGGTPGAFKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRNRT
DAMNRDSSDEHCVDISSVGNPLSHSGLKGARVDGASYFRHKERLLRISVRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLYVGRRRPLMSVWEQ
RTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVTLEKCAEEQGGKGERPPAE
GPEQPAPGANPGSGEDRRSPSPRAKRDKELWHQKSCHGNCEAGEQDGAGGSIGNRARMRQ
SQRRSRHRRARMEGKEPASALGSRSASQEVGLEEASPTEGAQDGDQCGDAAAAEALIQGD
LEASGEPIRLVLREGILHFPRDAELVGTTEEGSPLQAVPEPPRRKTGSLTEQDCSSLDTS
EQALLEASRTVSRSEPDLSSVTPNTEKATESTTIMIDVHDSAVVQISNKTDGEASPLKEA
EAKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLV
IAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLW
NILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCV
VTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKME
VKCREWKRHEFHYDNIVWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIF
YVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQ
NRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFS
LECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAAR
LIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINR
HNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVY
FVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYT
EMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIA
KGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSK
AKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLS
PQEIFQLACMDPAHGQFQEHQSLVVTDTSSMRRSFSTIRDKRTNSSWLDEFSMERSSDNT
YKSRRRSYHSSLQLSARRLNTDSGHGSDGHRSGGRERGRSKERKHLLSPDISRCNSEERS
PQAHDESPERRRESRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPK
PRPLLSYASMLRHTGDASLPAEESEGGSPLLSTLEPNAAGLTESSSSPVGKQSRQSTPQR
YISEPYLALHDDSHASDCGEEETLTFEAAAATRPASPILVPGGKPCPMKLWGRSLVLAGG
MGISCPLLGIACPLPAICEQFVAST
NT seq 6738 nt   +upstreamnt  +downstreamnt
atggctcgctttggggaggcggtggccggcaggctgggctccggagacggggggtccgac
cagaaccggagccggcaaggacctcctgctcctgcgggagggaccccgggagccttcaag
caaaccaaagcgcagagagcccggactatggctctgtacaaccccatccctgtccggcag
aactgcttcaccgtcaacagatcgctcttcctctttggggaagagaacatagtcaggaaa
tacgctaagaagctcatcgactggcctcccttcgagtacatgatcctggcgaccatcatt
gccaactgcattgtgctggccctcgagcagcacctccctgaggatgacaagacacccatg
tcacggagattagagaagacggagccctacttcatcgggattttctgctttgaggctggg
attaagatcgtggctctggggtttgttttccacaagggctcgtacctgcgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctcgccacagctgggacgcacttc
aacacccacgtggacctgcggacgctgcgggctgtgcgcgtgctcagacctctgaagctt
gtctcgggcattcccagcctgcagattgtgctgaaatccatcatgaaggccatggtgcct
ctcctccagattggcttgctgctctttttcgctatcctcatgtttgccatcattggcctg
gagttttacagtgggaagctgcaccgagcctgctacacaaacaattcaggtgaactagag
gagctggaccccccccatccgtgtggggtccagggttgccccccaggctacgagtgccga
gagtggattggtcccaacgatgggatcacgcagtttgacaacatcctctttgctgtgttg
actgtcttccagtgtatcaccatggaagggtggaccacagtcctgtacaataccaatgat
gccttaggagccacctggaactggttgtacttcatccccctcatcatcattggatccttc
tttgtcctcaaccttgtcctgggagtgctgtcaggggagtttgccaaagagcgtgagcga
gtggagaaccgccgagccttcatgaagctgcggcgccagcagcagatcgagcgggagctc
aacggctaccgggcctggatagacaaagcagaggaagtcatgctggctgaagagaacaaa
aatgctgggacctcagccttagaagtgctcaggcgagccaccatcaaaaggaaccggacg
gatgccatgaaccgtgactcgagcgatgagcactgcgtcgatatctcctccgtgggtaac
cccttaagtcactctggcctcaaaggcgccagagtggatggtgcctcctactttcggcac
aaggagcgactcctgcgcatctccgttcgccacatggtgaaatcccaggtcttctactgg
atcgtcttgagcctggtggctctcaacactgcctgcgtggccattgtccatcacaaccag
ccagcctggctcacccacttcctctactatgcagagttcctctttcttgggctcttcctc
ctggagatgtccttaaagatgtacgggatggggccacgcctttacttccattcttccttc
aactgctttgactgtggggtcacggtgggaagcatcttcgaagtggtttgggctatcttc
agaccaggaacctcttttgggatcagtgtcctacgagcccttcgtctcctgcgaatattt
aaaataaccaagtactgggcatccctgaggaatttggtggtgtcgctgatgagttccatg
aagtctattatcagcctgctcttcctccttttcctcttcattgtagtctttgccctcctg
ggaatgcagctgtttggaggcaggtttaacttcatcgatgggacgccgtcggccaacttt
gacactttccctgcagccatcatgacggtgttccagatcctgacgggtgaggactggaac
gaggtgatgtacaacggcatccgctcccagggaggcgttcgctcaggcatgtggtcctcc
atctatttcatcgtcctcaccttgtttggaaactatactctgctgaacgtgttcttggct
attgcggtggacaacctggccaacgctcaggagctcaccaaggatgagcaggaggaagag
gaggcctttaaccagaagcacgcccttcagaaagccaaagaagtcagccccatgtccgcc
ccaaacatgcctgctatcgaaagagacaggcgaaggagacaccacatgtcgatgtgggag
ccacgcagcagccacctgtatgtgggccgacgcagacccctcatgtcggtgtgggagcag
cgcaccagccagttgcgccggcacatgcagatgtccagccaggagggcatcaacaaggac
gagccacctctcatcaacccccacgccagcatcttccgcaggaagaaacccggggacggc
gtcaccctggagaaatgcgccgaggagcagggtggcaagggcgagcggccgccggctgag
ggccccgagcagccggccccgggggccaatcctggcagtggtgaggacaggaggagcccg
tcaccccgggccaagcgagacaaggagctgtggcaccagaaatcgtgccacgggaactgt
gaggcgggtgagcaggatggtgcaggaggcagcattgggaacagggcgcggatgaggcag
agccagcggcgcagccggcaccgcagagcccggatggaggggaaggagccagccagcgct
ctggggagccggtcggctagccaggaggtgggtctggaggaggccagccccacagagggg
gcgcaggatggggaccagtgcggtgatgcggccgcagcggaggcactgattcagggggat
ctggaggcgagcggagagcccatcaggttggtactcagggagggcatcttgcatttccca
cgcgatgccgagctggttgggaccaccgaggaggggagccccctgcaagcggtgcccgag
cccccccggcggaagacgggcagcctgacggagcaggactgcagcagcctggacaccagc
gagcaagcgctgctggaggccagccgcactgtcagccggagcgagcccgacctctcttct
gtcacccccaacaccgagaaggcaacggagagcaccaccatcatgatcgatgtccacgac
tctgctgtggtacagattagcaacaagacagacggcgaagccagccccttaaaggaggcc
gaggccaaagaggatgaggaggagatggagaagaagaagcggaagaaggagaaaagtgag
acgggcaaagcgatggtgccacacagctccatgttcatcttcagcaccaccaacccggtg
cggagggcttgccactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtg
attgccgccagcagcatcgccctcgcggcggaggatcccgtccttaccaactccgaccgc
aacaaagtcctgaggtattttgactatgtcttcactggcgtcttcaccttcgagatggtt
atcaagatgattgatcagggcttgatactgcaagatggttcctacttccgagacctctgg
aatatcctggatttcatcgtggtggtgggagcgctggtggctttcgccttggcgaatgct
ttggggaccaacaagggccgggatatcaagaccatcaagtctctccgtgtgctacgggtc
ttgaggcccctgaaaaccatcaagcgactgcccaagctgaaggccgtctttgactgtgtg
gtgacttccctcaagaacgtcttcaacatcctcatcgtctacaagctcttcatgttcatc
tttgctgtcattgccgtccagctcttcaaggggaagtttttctactgcactgacagctct
aaggacacggagaaggactgcatagggaactatgtggaccacgagaagaacaagatggaa
gtgaagtgccgggaatggaaacgccatgagtttcactacgacaatatcgtctgggctttg
ctcaccctgttcacagtctccaccggcgagggttggccccaggtgctgcagcattcggtg
gacgtgacggaggaggatcgtgggcccagccgcagcaaccgcatggagatgtccattttt
tatgtcgtctattttgtggtcttccctttcttctttgtcaacattttcgtggctctcatc
atcattacgttccaagagcaaggagacaaaatgatggaggagtgcagtctggagaagaat
gagagggcctgtattgactttgccatcagtgccaagcccctcacgcggtacatgccccag
aaccggcacaccttccagtaccgggtctggcactttgtggtctccccatccttcgagtac
accatcatggccatgatagcgttgaataccgtggtgctgatgatgaagtactactctgct
ccatacacctatgagctggccctgaagtacctgaacattgcattcaccatggtgttctcc
ttggagtgcgtcctcaagatcattgcttttggcttcctgaattatttccgggacacctgg
aacatctttgacttcatcaccgtcatcggcagcattacagagatcatcctgacggacacc
aagctggtgaacaccagcagcttcaacatgagcttcctgaagcttttccgggctgctcgg
ctcatcaagctgctgcgccagggttataccatccgcatcctgctctggacgttcgtgcag
tccttcaaggctctcccctacgtctgccttttgatagccatgcttttcttcatctatgcg
atcattgggatgcaggttttcggcaatatcaaactagatgaagaaagccacattaaccgg
cacaacaacttccgcagcttcttgggctccctcatgctcctcttcaggagtgccacggga
gaggcgtggcaggagatcatgctgtcctgcctggagggcaaaggctgcgagccagacaca
acggcgacatccgggcagaatgagaatgagcgctgtggcaccgacctggcctacgtttac
ttcgtctccttcatcttcttctgctctttccttatgctcaacctgtttgtggcggtcatc
atggacaattttgaatacctgactcgggattcctccatcctgggacctcaccatctagat
gagtttgtccggatctgggcagagtatgacagagcagcgtgtggccgaatccattacact
gagatgtatgaaatgctgactcttatgtcaccaccgctaggcctcggcaagagatgtcct
tccaaagtggcctataagagactggtgctgatgaacatgcctgtggctgaggacatgacg
gtccattttacctccaccttgatggcgctgatacgcacggccttggacatcaaaattgca
aaaggtggtgcagattggcagcagttagactctgagcttcaaaaggagatcctgaccatt
tggcctcacctgtcccagaagatgcttgacctgttggtacctatgccaaaaacctctgac
ctgactgttggcaaaatatacgcagccatgatgatcatggattactacaaacagagcaaa
gcgaaaaagcagcggcagcagctggaggagcagaaaaacgcccccatgttccagcgcatg
gagccgtcctccttgccgcaggaaatcatctcgaacgcgaaggctctgccctacctccag
caggacaccctctcaggcctgagcagccggagcgggttcccctcgctaagcccgctctca
ccgcaggagatcttccagctggcgtgcatggatccagcccacgggcagttccaggagcac
cagtctctggtggtgacggacaccagctcaatgcggcgatcattttccaccatccgggac
aagcgcaccaacagctcctggctggatgagttctccatggagcgcagcagtgacaacacc
tacaagtcccgccggcgcagctaccactcctcgctccagctctctgcccggcgcctcaac
accgactcgggccacgggtccgacgggcatcgctcaggcggcagggagcggggccgatcc
aaagagcgcaagcacttgctgtcccctgatatctcccgctgcaactctgaggagaggagt
ccccaggcgcatgacgagtcaccggagcggcggcgcgagtcccggtcacccagcgagggc
aggtcgcagacacccaacaggcagggaacgggctccctgagtgaaagctccatcccctcc
atctcggacaccagcaccccccggcgaggccgtcgccagctcccaccggtgccccccaag
ccgcgtcccctcctctcctacgcctccatgctgcggcacaccggagatgcctcgctgccc
gccgaggagagcgagggggggtccccgcttctctccactctggagcccaatgctgctggc
ctgaccgagtcttccagctccccggtggggaagcagagccgacagtccaccccgcaacgc
tacatctcggagccctacctggccctgcacgacgactcgcacgcctcagactgcggtgag
gaggagacgctcaccttcgaggcggccgccgccacccgtcctgcatcccctatcttggtg
cctgggggcaagccgtgccccatgaagctgtggggaaggtccctggtgctggctggtggc
atgggcatctcctgtccccttctgggcatcgcctgtccccttccagccatctgtgagcag
ttcgtggcttcaacctga

DBGET integrated database retrieval system