KEGG   Pygoscelis adeliae (Adelie penguin): 103914682
Entry
103914682         CDS       T06012                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103914682 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103914682 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:padl04052]
    103914682 (KITLG)
Cytokines and growth factors [BR:padl04052]
 Growth factors
  Growth factors (RTK binding)
   103914682 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 103914682
NCBI-ProteinID: XP_009319642
LinkDB
Position
Unknown
AA seq 294 aa
MTGGSQEPSVLEVETWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDY
MITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRII
NDLMACLAFDKNKDFVKENGHLYEEGRFIPEDFFRHFNSTIEVYKEFADTLDKNDCILPS
TVETPENDSRVAVTKTFLFPPVAASSLRNDSIGSNTSSNKEALGFISSSSLQGISIALTS
LLSLLIGFILGAIYWKKTHPKSRPESDETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 885 nt   +upstreamnt  +downstreamnt
atgacgggaggatcccaagaaccatctgtgttggaggttgagacttggattatcacttgc
ttttgtcttcaactactcctacttaatcctcttgtcaaagcccagagttcctgcgggaat
ccagtgacagatgatgtgaatgacattgcaaaattggtcggaaatctcccaaatgattat
atgataacccttaaatatgttccgaagatggatagtctgcctaatcactgttggttgcat
ttgatggtgcctgagttttcaagaagtctacataatcttctccagaaattttcagatatt
tcagatatgtctgatgttttaagcaactattcaatcatcaataatctcacaaggataatt
aatgatcttatggcatgcctagcttttgataaaaataaggattttgtaaaagaaaatggt
cacctttatgaagaaggtcgcttcattcctgaggatttttttaggcactttaatagtacc
attgaggtctacaaggagtttgcagacacgttggataagaatgactgtattctgccttca
acagtagaaacaccagagaatgattccagagtcgctgtcacaaaaacatttttgtttcct
cctgttgctgccagctcccttaggaatgacagcattggcagtaacactagcagtaacaaa
gaggcacttggcttcattagcagctccagcctgcaagggatcagcatagcactgacatca
ttgctgtctcttcttattggctttattttgggagccatatactggaagaaaacacatccc
aaatccagaccagaaagtgatgaaactacacagtgtcatgactgtcaagaggaaaatgag
ataagtatgttgcagcaaaaagaaaaagaacatctacaagtgtag

DBGET integrated database retrieval system