KEGG   Pygoscelis adeliae (Adelie penguin): 103917238
Entry
103917238         CDS       T06012                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04012  ErbB signaling pathway
padl04068  FoxO signaling pathway
padl04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103917238
   04068 FoxO signaling pathway
    103917238
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103917238
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103917238
NCBI-ProteinID: XP_009322627
LinkDB
Position
Unknown
AA seq 123 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKW
SLXDQKTDVSENQTDFAEQCTGQRKRPATDGNVPLRKRQRFSPPALLVSAPGLSAPSPVP
RVA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgtatttctaatgggagccctaccctggagcgcatggaagccaggcag
tcggagtacccgaagccgtcagcttgcaggaacctcttcgggccggtgaatcacgaagag
ttaaacagggacttgaagaagcaccgccaggagatggaggaggcatgccagaggaagtgg
tcactgtgagatcaaaagactgatgtttctgaaaatcagacggactttgcagagcagtgc
actgggcagaggaaaagacctgccaccgatggtaacgtacccttgcgaaagcgacagcgc
ttttctccgcctgccctgctggtgtcagcgccggggctctcggctccctcgcccgtgcca
cgcgtggcctga

DBGET integrated database retrieval system