KEGG   Pygoscelis adeliae (Adelie penguin): 103917239
Entry
103917239         CDS       T06012                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04012  ErbB signaling pathway
padl04068  FoxO signaling pathway
padl04110  Cell cycle
padl04115  p53 signaling pathway
padl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103917239
   04068 FoxO signaling pathway
    103917239
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103917239
   04115 p53 signaling pathway
    103917239
   04218 Cellular senescence
    103917239
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103917239
NCBI-ProteinID: XP_009322628
LinkDB
Position
Unknown
AA seq 153 aa
MEQRLGKTTRARRNLFGPVDHEQLWQDFQHMLRHSVEGAQQKWNFDFLRDVPMEGLLQWE
ELEGHKVPAFYHSCMVGDAQRPLQHLNGSLSREDKSHHFAQVALTEKPKTSEKTGGKRIS
EGKERRQTALTDYYSAKKQVKMNMHAAAKKSAS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagcagaggctggggaagacaacccgcgcccggaggaacctctttggccccgtagac
catgagcagctgtggcaggacttccagcacatgctgcgccacagtgttgagggggcccag
cagaagtggaacttcgatttcctccgggatgtgccgatggaggggcttctgcagtgggaa
gagcttgagggccacaaggtgcccgccttctaccacagctgcatggtgggagatgctcag
agaccactgcagcacttgaacgggtcactgagcagggaggacaagagtcaccactttgcc
caggtggcactgactgagaaacccaaaacttctgagaaaacaggaggcaagaggatctca
gaagggaaggaaagaagacagacagctttgacagattactactcggcaaagaagcaggtc
aaaatgaatatgcatgctgctgcgaagaagtcagcttcttga

DBGET integrated database retrieval system