KEGG   Pygoscelis adeliae (Adelie penguin): 103919595
Entry
103919595         CDS       T06012                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04060  Cytokine-cytokine receptor interaction
padl04068  FoxO signaling pathway
padl04144  Endocytosis
padl04218  Cellular senescence
padl04350  TGF-beta signaling pathway
padl04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103919595
   04350 TGF-beta signaling pathway
    103919595
   04068 FoxO signaling pathway
    103919595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103919595
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103919595
  09143 Cell growth and death
   04218 Cellular senescence
    103919595
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103919595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:padl01001]
    103919595
Enzymes [BR:padl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103919595
Protein kinases [BR:padl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103919595
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM FixQ
Other DBs
NCBI-GeneID: 103919595
NCBI-ProteinID: XP_009325402
LinkDB
Position
Unknown
AA seq 424 aa
MGYWRRPGLLSLLLLSFSCSAGARRSLKTNLCKWCDSTLPACEEKVCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSEDGITYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRAK
AWGSRHVLSWMDLQKMAGSLVSGVAHLHSDYTACGRPKIPIAHRDIKSTNVLVKNEQECV
LCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLESRVNLEDLESFKQMDVYSMALVL
WEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRGRPEIPSSWLVHQGMRFLC
DTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNTDNEASKTASPGGEHQDSDGN
RNMQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggttactggaggagaccgggtctgctttccttactgctgctctccttctcctgcagc
gctggcgcccgccgcagcctgaagaccaacttgtgcaagtggtgcgactccacgctgccg
gcctgcgaggagaaggtgtgctacagcaactgcaacctcaactcctactgcgaggacccc
tacgagatctgcgtggccatatggagacaggacaacgagagcatcaggatcagcacgctc
tgccacaacccccaccgccccatcgaaaacctcatggtccccaactacaacacctcgcgc
tgcatcatgacccatcagcccagcgaggacgggatcacctacatctgcggctgcgtggac
gagcaagagtgcaacgataaacttatctttgaaaaccacaccaatggctactccatgctg
cagagcaaagaggtcatcccagtggccgccatcagcctcctgcccccgctgctggtggcg
gtgatgatcacggtgatattttacctctgccgcacgcagaagcggcgcaagagagccaag
gcgtggggctcccgccacgtcctgagctggatggacctgcagaagatggcgggctccctg
gtgagcggggtggcccacctccacagcgactacaccgcctgcggcaggccaaaaatcccc
attgcccaccgggacatcaaaagcaccaacgtcctagtgaagaacgagcaggagtgtgtg
ctctgcgacttcggcatcgccatacgccttgacccttccctgacggtggacgactttgcc
aacagtgggcaggtgggcaccgccaggtacatggccccagaggtcctagagtccagggtg
aacctggaagacctggagtctttcaagcagatggacgtctactccatggccctcgttttg
tgggaaatggcctccagatgtgaagtggtaggagaggtaaagaattatgagctgcctttt
gggtcaaaagtccaggagcagccctgcgtggataccatgagggacatcgtgctgcatggc
agaggacgccccgagatcccaagcagctggctagtacatcagggaatgcgttttctgtgc
gacaccatcacggagtgctgggaccacgaccccgaggctcgcctcaccgcccactgcgtg
gccgagcgcttcaacctgatggcacagatggattgcgacgacatcctcaacaacaacacg
gacaacgaggccagcaaaacagcttctccaggcggggagcaccaggacagtgatgggaac
agaaatatgcagtga

DBGET integrated database retrieval system