KEGG   Pygoscelis adeliae (Adelie penguin): 103923131
Entry
103923131         CDS       T06012                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103923131 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103923131 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:padl04052]
    103923131 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:padl00536]
    103923131 (FGF1)
Cytokines and growth factors [BR:padl04052]
 Growth factors
  Growth factors (RTK binding)
   103923131 (FGF1)
Glycosaminoglycan binding proteins [BR:padl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103923131 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103923131
NCBI-ProteinID: XP_009329661
UniProt: A0A093P7C1
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTKSGQYLAMDTNGLLYGSQLLGEECLFLERIEENHYNTYVSKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggaaatcactaccttcaccgccctgaccgaaaagttcaaccttcccctg
gggaactacaagaaacccaaactcctgtactgcagcaacgggggccacttcctacggatc
ctcccggacggcaaagtggatgggaccagggaccgaagcgaccagcacattcaactccag
ctaagtgcggaaagcgtgggagaggtgtatataaagagcaccaagtctgggcagtacctg
gcgatggacaccaatgggctgctctacggctcgcagttactgggtgaggagtgcctgttc
cttgaaaggatcgaagaaaaccattacaacacgtacgtctccaaaaagcatgcggataag
aactggtttgttggtctgaagaagaatgggaacagcaagctggggccgcggactcactat
ggccagaaggcgatcctcttcctcccgctgcccgtctcggccgactaa

DBGET integrated database retrieval system