KEGG   Pygoscelis adeliae (Adelie penguin): 103924366
Entry
103924366         CDS       T06012                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04020  Calcium signaling pathway
padl04260  Cardiac muscle contraction
padl04261  Adrenergic signaling in cardiomyocytes
padl04270  Vascular smooth muscle contraction
padl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103924366 (CACNA1C)
   04020 Calcium signaling pathway
    103924366 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103924366 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103924366 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103924366 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103924366 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:padl04040]
    103924366 (CACNA1C)
Ion channels [BR:padl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103924366 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 103924366
NCBI-ProteinID: XP_009331160
LinkDB
Position
Unknown
AA seq 2115 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQN
GTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSL
VIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDID
PENEDEGMDEEKPRNMSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRR
WNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFT
AEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIF
KITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRST
FDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVF
LAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKS
ITADGESPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLK
EKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSF
RNQILFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQS
SAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
QLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWENSKFDFDNVLTAMMAL
FTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVT
FQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLXXXX
XLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFL
IVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTL
LWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLL
FRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAII
KKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNAL
SLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDGRSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTIRVQEAPWKLPSKRTHYYETLGRSSSRD
SQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDT
RHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLL
QRSHSPTMFSRLCATPPATPCSRGWPQQTIPTLRLDGAESSEKLNSSFPSVHCGSRYADN
TGCSSPRRARPVSLTVPSQTGGSSRQFHGSAGSLVEAVLISEGLTQFAQDPKFIEVTTQE
LADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRK
SQEELKDSRIYISSL
NT seq 6348 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcagctgcagggcttgccccagagcatatccctactccaggggcagct
ctgtcctggcaagctgcgattgatgctgccaggcaagccaaactgatgggtagtgctggc
aatgcaacaatatccacggctagctccacgcagagaaaacggcagcagtatgggaaacag
aaaaaacagggtaccaccacagctacacgtcctccccgggcactgctatgtttaacactg
aaaaatcccatccggagggcatgcatcagcatcgtcgaatggaaatcatttgaaataatt
attttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaa
gatgattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataatt
tttacagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgct
tacctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagt
gcaattttagaacaagcaaccaaagcagatggggggaattcaataggaggaaaaggtgcc
ggattcgatgttaaagcactgcgggctttccgagtattgcgtccattacggctggtgtct
ggagttcctagtctccaggtggttttaaattcaattatcaaggccatggtccctttgttg
catattgccctgctggtgctgtttgtcattattatctatgccatcattggactggagtta
ttcatggggaagatgcataaaacctgctaccatgtgcaagggggacttatagatacgcct
gcagaagatgatccgtctccctgcgccccccagtctgcgcatgggcggcagtgtcagaac
ggcacagagtgcaaggcaggctgggagggtcctaagcacggcattacgaactttgacaat
tttgcttttgccatgctgacggtgtttcagtgcatcacgatggagggctggacagatgta
ctgtactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctg
gtcatctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttt
tccaaagaaagagagaaggctaaagctcggggcgatttccagaagttacgggaaaaacaa
cagctagaggaggatttgaagggatacttagactggataactcaagcagaagatattgac
ccagaaaatgaagatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccacc
agtgagactgagtccgtgaacacagacaacgtccctggagcagatattgaaggcgaaaac
tgcggtgctaggctagcgcatcggatctcaaaatcaaagtttagtcgctactggcgccga
tggaatcgattctgcagaagaaagtgccgcgccgctgtcaagtccaatgttttctactgg
ttggtgattttccttgtgtttctcaacactcttaccattgcctctgaacactacaaccag
ccagactggctcacggaggtccaagacactgccaataaggtgctgctagctcttttcacg
gcagagatgctgctgaagatgtacagccttggtctccaggcctattttgtgtccctcttc
aaccgctttgactgtttcattgtgtgtggaggaatcctggaaaccattctggttgagaca
aagatcatgtcaccactgggcatttcggtgttaagatgtgttcgactcctaagaatattt
aaaatcacaagatactggaactccctgagtaaccttgtggcttcactcctgaattcagtc
cgctccattgcctccctgttgctgcttctcttcctcttcattatcatattctcactcctg
ggtatgcagctctttgggggcaagtttaactttgatgagatgcagaccaggaggagtaca
ttcgacaacttcccccagtccctcctcactgtgtttcagatcctgactggggaggactgg
aattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttg
gtctgtatttacttcatcatcctcttcatctgtggaaactatatcttgctgaatgtattt
ttggccattgctgtggacaaccttgctgatgctgagagtttaacatctgcacagaaagag
gaggaagaggaaaaagaaaggaaaaagctagctagaactgctagtcccgaaaagaaacag
gagatagaaaaaacagctgtggaggaggagacaaaggaggagaaaattgagctgaaatcg
atcactgctgatggagaatccccgcctgctaccaagatcaacgtggatgattatcagccc
aatgaaaatgaagaaaagagcccatatcccacaacagaagcaccagcagaggaagatgaa
gaagaacccgagatgcctgttggcccccggcctcgcccaatgtctgagctgcacctcaag
gaaaaggctgtgcccatgcctgatgccagtgcttttttcatcttcagtcctaacaacagg
tttcgtgtccactgccatcgaatcgttaacgataacattttcaccaacctgatcctattt
ttcatcttgctcagcagcatctccttggcagctgaggaccccgtccgacacctctccttt
aggaaccaaattctcttttattttgatatagtttttactgtcattttcaccattgaaatt
gctctgaagatgaccgcatacggggctttcctccataagggctccttctgcagaaactat
ttcaacatcttagacctgctggtggtcagcgtttctctcatctcttttgggatccagtcc
agtgccatcaatgtggtgaagatcctgcgtgttctgcgagtgcttagaccactgagggcc
atcaacagagccaaaggactaaagcatgtggtccagtgtgtgtttgtcgccatccgaacc
atcggaaacattgtgattgtcaccactttgctgcagttcatgtttgcctgcattggagtt
caattgtttaagggcaagctgtacagctgcactgatagctccaagcagacggcagcagaa
tgcagagggtactacattacatacaaggatggtgaggtcaaccagccgatgatacagccc
cggagctgggagaacagcaagtttgacttcgacaacgtcttgactgccatgatggctctc
ttcactgtctcaacctttgagggctggccagagttgctgtataggtccattgattcccac
atggaggatgtgggacccatctataatcacagggttgagatctccatcttctttattatc
tacatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcaca
tttcaggaacaaggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccag
tgtgtagaatacgctctgaaggcccggcctctgcggagatacatccctaaaaaccagtac
cagtacaaagtttggtatgtggtcaactccacctattttgaatacctnnnnnnnnnnnnn
ntgctgaacaccatctgcctggccatgcaacactacggtcagagctgcatgttcaaggaa
gccatgaatatcctcaacatgctcttcactggcctcttcactgttgagatggttctgaaa
ttaatcgccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctc
atcgtaattggcagcattatagacgtcattctcagtgaaactaatccagctgaacatacc
caatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccga
ctcttccgcgtgatgcgtctcgtgaagctcctgagccgaggggagggcatccggacactg
ctttggaccttcatcaagtccttccaggctctcccctatgtggctcttttaatagtgatg
ttgttcttcatctacgctgtgatcgggatgcaggtgtttggtaaaattgcactgaacgat
accacagaaatcaaccgaaacaacaacttccagaccttcccccaggcagtgctgctgctt
ttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcatgtctcccagacaag
aagtgcgacccagagtcggagccggccaactccaccgaagctgatcactcctgtggcagc
agcttcgccgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaat
ctttttgtagctgttataatggataactttgattacctgacacgggactggtccatttta
ggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagccaag
ggacggatcaaacacttggacgtggtgacactgctccggcggatccagccccccctgggc
ttcgggaagctctgcccgcaccgggtggcttgcaaacgccttgtctccatgaatatgcca
ctgaacagtgatgggactgtcatgttcaatgccactctctttgcgttggtcagaacagca
ctgaggatcaagacagaaggtaacctggagcaagccaacgaagagctgagagcaataatt
aagaaaatctggaagcgcacaagtatgaagctgctggaccaggtggtgccccccgcaggt
gatgacgaggtgaccgtcgggaagttctatgccactttcctgattcaggagtatttccgg
aagttcaagaaacgtaaagaacagggactggtgggcaagccctcccagcgcaacgcgctc
tccttgcaggctggtctgcgcacacttcacgacattgggccagagatccgacgagcaatt
tctggagacctgacagctgaagaagagctagataaggccatgaaagaagctgtttcggct
gcctctgaagatgatatcttccggagagccggaggcttgtttggaaaccatgtcagctat
taccaaagtgatggcaggagtgcgttcccccagacattcaccacccagcgacctttgcac
atcaataagtctggcaacaaccagggggataccgagtctccatctcacgagaagttggtg
gactccaccttcactcccagcagctactcatcttcaggctccaatgccaacatcaataat
gccaacaacactgccctgtgccgcttccccagcccacccagctaccccagcactgtcagc
acagtggaaggccacgggacccccttgtcaccaaccatacgtgtgcaggaggctccttgg
aaactaccttccaaaaggacacattactacgaaacactgggacgctccagttccagagac
agccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaat
ttgaatgaagacattgagtactgtagtgaaccaagtctgctctctactgaaatgcttgca
taccaagatgatgaaaacagacaacttactccaccagaaaacaacaaaggagaggacacc
cggcactctccgaagaaagggtttctgtgctcctcagcactaggtcgaagagcatccttt
cacttagagtgtctgaaaagacagaaaaaccagggtgtagatgtctcgcagaagacagtt
ctgcctttgcatctggtacatcatcaggcattagcggtggccggcctgagtcccctgctc
cagcgaagccattcccccaccatgttctctcggctgtgtgctacaccccctgctacaccc
tgcagccgtggctggccgcaacagaccatcccgactctgcgcctcgacggggcagagtcc
agtgagaagctcaacagcagcttcccgtcagtacactgcggctctcggtacgctgacaac
accggctgcagcagcccgaggagagccaggccggtctccctcaccgtccccagccagact
ggagggagcagcaggcagtttcacggcagcgctggcagcctggtcgaagcggtcttgatt
tcggaaggactgacgcagtttgctcaagatccaaagttcattgaggtcacaacccaggag
ctcgcagacgcctgtgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctcttgccttttgttaactgcagggac
ccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtagaaaa
agtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system