KEGG   Pygoscelis adeliae (Adelie penguin): 103925769
Entry
103925769         CDS       T06012                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04068  FoxO signaling pathway
padl04110  Cell cycle
padl04115  p53 signaling pathway
padl04218  Cellular senescence
padl04310  Wnt signaling pathway
padl04340  Hedgehog signaling pathway
padl04371  Apelin signaling pathway
padl04510  Focal adhesion
padl04530  Tight junction
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103925769 (CCND1)
   04340 Hedgehog signaling pathway
    103925769 (CCND1)
   04371 Apelin signaling pathway
    103925769 (CCND1)
   04068 FoxO signaling pathway
    103925769 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103925769 (CCND1)
   04115 p53 signaling pathway
    103925769 (CCND1)
   04218 Cellular senescence
    103925769 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103925769 (CCND1)
   04530 Tight junction
    103925769 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103925769
NCBI-ProteinID: XP_009332812
UniProt: A0A093NL51
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctagatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgttggaggtttgcgaggagcagaagtgcgaagaggaggttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system