KEGG   Pygoscelis adeliae (Adelie penguin): 103925936
Entry
103925936         CDS       T06012                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04012  ErbB signaling pathway
padl04068  FoxO signaling pathway
padl04110  Cell cycle
padl04115  p53 signaling pathway
padl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103925936 (CDKN1A)
   04068 FoxO signaling pathway
    103925936 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103925936 (CDKN1A)
   04115 p53 signaling pathway
    103925936 (CDKN1A)
   04218 Cellular senescence
    103925936 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103925936
NCBI-ProteinID: XP_009333018
LinkDB
Position
Unknown
AA seq 150 aa
MPLSQSRAGQMPCSSKVCRNLFGPVDHHQLQNDFEDLLKQHLEEAQQRWNFNFETETPLE
GHFKWERVFLAEQPPQEVHSLVKVTSSESRSSLVHKVPPEDRLGRICPEGSQQSSEVYRA
GSPQSLKRGQTTIKDFYSSKRRIVPDKPKP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgcccctgtctcagagcagggccgggcagatgccatgcagcagcaaggtgtgcaggaac
ctctttggccccgtggaccaccaccagctccagaatgactttgaggacctgttgaagcaa
cacctggaagaagctcagcagcgctggaacttcaactttgagacggagactcccttggaa
ggacacttcaagtgggagagggtcttcctggctgagcagccgccccaggaggtccacagc
ctggtcaaggtcaccagcagtgagagcaggagctccttggtccacaaggtcccccctgag
gaccgtcttggcaggatttgccccgaggggtctcagcagagctcggaggtttacagggct
ggttccccacagagcttgaaacgtgggcagaccaccatcaaagacttctacagctccaag
cggaggatcgtccctgacaagcccaagccgtga

DBGET integrated database retrieval system