KEGG   Pygoscelis adeliae (Adelie penguin): 103926287
Entry
103926287         CDS       T06012                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04020  Calcium signaling pathway
padl04144  Endocytosis
padl04510  Focal adhesion
padl04540  Gap junction
padl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103926287 (PDGFRA)
   04020 Calcium signaling pathway
    103926287 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103926287 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103926287 (PDGFRA)
   04540 Gap junction
    103926287 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103926287 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:padl01001]
    103926287 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:padl04090]
    103926287 (PDGFRA)
Enzymes [BR:padl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103926287 (PDGFRA)
Protein kinases [BR:padl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103926287 (PDGFRA)
CD molecules [BR:padl04090]
 Proteins
  103926287 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 103926287
NCBI-ProteinID: XP_009333418
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPWMFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPKAQVTLINSLDKAVYAFYDSKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccatggatgttcctgatcctgggatgttttctcacaggaccattccta
acattttgccagcttcctctgccgactattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacgctcaaatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacattagacatgaagaaaacaacagtggcctcttc
gtgacggtgctcgaagtaggaaatgcctcagctgctcatacgggcttgtatgtttgctat
tataaccacactcaagtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcattctagtcgaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaaaagctcaagtgacttta
attaacagtttggacaaggctgtctatgctttctatgacagtaaacaaggcttcataggg
aatttccctgcaggctcatatacatgcaaaacaatggttaaaggcgtggagttcaagtct
gatgagttcctcatctatattttaagagctacttcacagctgccagttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccattgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacaatggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcgttcacctggagcctcag
tttagccctctggaagctgtcaatctacatgaagtaaaaaattttgtcgtcgatgtgcag
gcatacccagctccaaaaatgtactggttgaaggataacgtgactctgattgaaaatctt
actgagattgttactagttcaaatagagtccaggaaacaaggtttcagagtatattaaaa
ttgatccgggccaaggaagaagacagcggatactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctccttgctaatacaagttccagccctgatcttagacctc
gtggatgatcaccatggctctgcgggggggcaaacggtgaggtgcttggcagaggggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatggactcttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaacatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgggaactgaagcttgtggctcccacc
ttgcgatcagaactaacggtggctgctgcagtcttagtgctgttagtgattgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccgaggtatgagataagatggaga
gtcattgagtctatcagccctgatggccacgaatacatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tccggtgcatttggaaaagtagttgaagggactgcgtatggattgagtcgctctcaaccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatctcgggccccacctgaatattgtgaatcta
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgcttttatggt
gatttggtgaactatctgcataagaacagggacaatttcctgagccgacacccagagaag
ccaaagaaagatttggatatctttgggatgaacccagctgacgaaagcacaagaagttat
gtgatattatcatttgaaaacactggagaatatatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaaatctatgtcagaatcggaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagtactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gttgattctactttctacaataagatcaagagtggataccgaatggccaaacccgatcat
gctaccaatgaagtgtacgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggactgtgacaacgcttacattggtgtcacctacaagaatgaagacaagttaaag
gacagggagagcggatttgatgagcagaggctgagtgctgacagcgggtacatcatcccc
ctgccagacattgaccctgtttctgaagatgagcttggcaaaaggaataggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system