KEGG   Pseudomonas aeruginosa PAO1: PA0140Help
Entry
PA0140            CDS       T00035                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PA0140 (ahpF)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PA0140 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Glutaredoxin K_oxygenase NAD_binding_7 Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 879326
NCBI-ProteinID: NP_248830
UniProt: Q9I6Z2
LinkDB All DBs
Position
158907..160472
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
KPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLDADVIEQVKGIEGTFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVEARQIMSVPSIYLNGEVF
GQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEVDIMNLQRASKLVPAKNAGE
LHEVRFESGGSLKAKTLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVEVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaaacccagttgaaggcctacctggaaaaggtcagccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagctgctgggcctgctg
caagacatcgtcggcctgaccgacaagatcaccctgaagaccgacggcagcgatgcgcgc
aaaccgtcgttctcgctgaaccgccccggtgcggacatcggcctgcgcttcgccggtatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtaggcggccacccc
tccaagctcgacgcggacgtgatcgagcaggtcaagggcatcgagggcaccttcgagttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgtcacgtcgccatcgacggcgcgctgttccaggat
gaggtcgaggcgcgccagatcatgtcggtgccgagcatctacctcaacggcgaagtcttc
ggccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgccgcc
cgcgacgccgagaagctgaccgcccgcgacgccttcgacgtgctggtggtcggcggtggc
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcattcgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
caggagaccgaagggccgaagctggcacgggcgctggaagagcacgtgcgtcactacgag
gtcgacatcatgaacctgcagcgcgccagcaagctggttccggcgaagaacgccggcgag
ttgcacgaggtgcggttcgagagcggcggcagcctcaaggccaagaccctgatcctcgcc
accggcgctcgctggcgcgaaatgggcgtgcccggcgagcaggagtacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactctggcgtcgaggcggccatcgacctggccggcatcgtcgcccatgtg
accctgctggaattcgacagcaagttgcgcgccgatgccgtgctgcaacgcaagctctac
agcctgccgaacgtcgaggtgatcaccagtgccctgaccagcgaagtgaagggcgacggc
cagaaggtcaccggcctggtgtacaaggaccgcaactccgaggagttcaagtcgatcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcagc
gtcgagctgtcgccgcgtggcgagatcatcgtcgacgcccgtggcgagacctcgctgccc
ggcatcttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttcgctgagcgccttcgaccacctgatccggacctccgcgccg
gagtga

DBGET integrated database retrieval system