KEGG   Pseudomonas aeruginosa PAO1: PA1033Help
Entry
PA1033            CDS       T00035                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PA1033
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PA1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 880186
NCBI-ProteinID: NP_249724
PathoGenesis: PA1033
UniProt: Q9I4U1
LinkDB All DBs
Position
complement(1122340..1122981)
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLDQRLADRAFVAGDDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccaccccgaacggccacaagattactcttttcctggaa
gaaaccggcctgccctacgccatccatccgatcaacatcagccagggcgaccagttccag
gcggatttcctgaaggtgtcgccgaacaacaagattcccgccatcgtcgatcgccaaccg
gccgacggcggcgctcccctgtcgctgttcgagtccggcgccatcctgctctatctcgcg
gaaaagactggacgcttcctcgccaaggacctgcgcgcgcgccaggaaaccctgcagtgg
ctgttctggcagatgggcgggctggggccgatggccgggcagaaccaccatttcaaccgc
ttcgccccggagaagattccctacgccatcgaccggtacgtcaaggaaaccgcgcgcctg
tacggcgttctcgaccagcgcctggcggaccgcgccttcgtcgccggcgacgactacagc
atcgccgacatggccatctatccgtggatcgtcccgcaccagtggcaggagcaggatctc
gccgacttcccgcacctgcagcgctggttcgagagcattcgccagcgtccggcgacgcaa
cgcgcctatgctttggtggagcgcatcaatccgccgaagtag

DBGET integrated database retrieval system