KEGG   Pseudomonas aeruginosa PAO1: PA2241Help
Entry
PA2241            CDS       T00035                                 

Gene name
pslK
Definition
(RefSeq) biofilm formation protein PslL
  KO
K21004  polysaccharide biosynthesis protein PslK
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA2241 (pslK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurJ Polysacc_synt_3 MatE Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 880828
NCBI-ProteinID: NP_250931
UniProt: Q9I1M8
LinkDB All DBs
Position
2466540..2467949
Genome map
AA seq 469 aa AA seqDB search
MLGSAFWLTLATLLGLCLGFAREWLLVASWGAGERSDAFLIALFLPEALRMSLAGGVLSA
AALPLFLERQGERRLDWLAAILPALLGIAVALSLLLLAAAPWLVRLLGPGLAETASAQAA
ANLRVLAWCVPGLMLHALFSIPLQAAERFVLAGLGSLLFNLPPVLYLALHGQASQPEQLA
LACLLGSLLMPLVLLPSLWIEGWRPWHWRLSGVELGELGGRIAPLLLSNAASQGLALVER
LVASLLGEGAVTWVNLARKLMNLPLIALMSLNQVLLGMMSRRQGGERLALLRRGLETASL
LTLPAGVGLVAAAPGLVALLLPRQTAGSPLPALLAWFAVPLVFGAWNALLARYAYAAGDT
RLPLRCELLGSALNAALLAVLPLIFGLPGIPLAALGGVLCTALLLMRRQALLGALPWARL
WLLNALAMALAAGLLFRIDGIWLQLGLGTVAGCLALLGMALWLRPWRTD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgctcggctccgccttctggctgacccttgccaccctgctcggcctgtgcctgggcttc
gcccgcgaatggctgctggtggcctcctggggcgccggcgagcgcagcgacgccttcctc
atcgccctgttcctgcccgaggccctgcgcatgtcgctggccggcggcgtgctcagcgcg
gcggccctgccactgtttctcgaacgccagggcgaacgtcgcctcgactggctggcggcg
atcctcccggcgctgctcggtatcgccgtggcgctcagcctcctgctgctggcggcggcg
ccctggctggtgcgcttgctcggcccgggcctggccgagacggccagcgcccaggccgcg
gccaacttgcgggtcctcgcctggtgcgtgccggggctgatgctccatgcgctattcagc
atccccctgcaggccgccgagcgcttcgtcctggccgggctcggctcgctgctgttcaat
ctaccgccggtgctctacctggccttgcacggccaggccagccagcccgaacaactggcc
ctggcctgcctgctcggcagcctgctgatgccgctggtgctgctgccttcgctatggatc
gagggctggcggccctggcactggcgcctttccggcgtcgaactgggcgagcttggcggg
cgcatcgctccgctgctgctgagcaacgccgccagccagggcctggcgctggtcgagcgg
ctggtggcctcgctgctcggcgaaggcgcggtgacctgggtcaacctggcgcgcaagctg
atgaacctgccgctgatcgccctgatgagcctcaaccaggtgttgctcggcatgatgagc
cgacgccagggtggcgagcgtctggccctgcttcgccgcggcctggagaccgccagcctg
ctgaccctgccggccggggtcgggctggtcgctgccgcacccggcctggtggccctgttg
ctgccgcggcagaccgccggctcgccgttgccggcgctgctggcctggttcgccgtgcca
ctggtgttcggcgcctggaatgccttgctggcgcgttacgcctacgccgccggcgatact
cgcctgccgctgcgctgcgagctgctcggcagcgcgctgaacgccgcgctgctggcggtc
ctgccgttgattttcggactgccggggattcccctcgcggcccttggcggggtgctctgc
accgcgctgctgctgatgcgtcgccaggccctgctcggcgccctgccctgggcccggctg
tggctactgaacgccctggccatggcgctcgccgccggcctgctgttccgcatcgacggt
atctggctgcaattgggcctgggcaccgtcgccggctgcctggcgctgctcggcatggcg
ctctggctgcggccctggcgcaccgattga

DBGET integrated database retrieval system