KEGG   Pseudomonas aeruginosa PAO1: PA2424Help
Entry
PA2424            CDS       T00035                                 

Gene name
pvdL
Definition
(RefSeq) peptide synthase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 882838
NCBI-ProteinID: NP_251114
PathoGenesis: PA2424
UniProt: Q9I157
LinkDB All DBs
Position
complement(2707666..2720694)
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALQRLDLSGWRVAFSGSEP
IRQDSLERFAEKFAASRFDASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGEGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNPEASAKA
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQEAQPPAGDDELLARIGEIWKARLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGL
PAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGAALQRIDERGEFAWQFVDLAALAEHERAAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDTAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAAHLAEWGSAPCEPARAWLPELLERQLAQ
SAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYTLDGDDVLMQKAPV
SFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSAAG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAVGAEAEAEQNQRLRAALQAELPEYMVPTQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRSHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVARWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIECFGMRAEDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTG
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
QVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAE
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLARREHWNQALLLQPRQ
AIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLVVDGVSWRVLLEDLQQVYRQFAEG
AEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQPVEWPCDRPQGDNREALA
ESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDARTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYSALGESRPANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAP
TVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDPGHPTQRLTRIVELSRTLVLVCTQACREQALALFDELGCVDRPRLL
VWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAVAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQEGANGKYLVGYLVPGETPRSSADSPAGLMVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLDRMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttcccaccaccctggtccaggccctgcgtcgccgcgctgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctatcgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgatcgcgcggtactgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggttgcctgtatgccggggtcatcgcggtgccggcctacccgccggaatcggcg
cgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcgcaactgtccgccgcc
aacgccccgcaactgctctgcgtcgaccagttggacccggccgttgccgaggcctgggac
gagccgcaagtgcgtcccgagcacatcgccttcctccagtacacctccggttcaaccgca
ttgcccaagggcgtgcaggtcagccatggcaacctggtcgccaacgaggtgctgatccgc
cgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgtccggtgcgctggctggaagccatcagccagtacggc
ggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagcgagcgggtcgccgag
tcggccctgcagcgtctcgacctgagcggttggcgggtagccttctccggttccgagccg
atccgccaggacagcctggaacgcttcgccgagaaattcgccgccagccgcttcgacgcg
tccagtttcttcgcctgctacggcctcgccgaggcgaccctgttcgtcaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgaaggcagcgtgctgatgtgctgcggccgcagccagccggaacacgccgtg
ctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaacgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcttcggcgaaggcc
ttcgtcgagcgtgacgggcgcacctggctgcgcaccggcgacctcggcttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccgcggccacaacctc
tatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcggcgcgcaagggcagg
gtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggcatcgccgccgagatc
ggtcgcggcgtccagaaatcggtgccggcccaggagctgatcgactcgatccgccaggcg
gtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaagacgtccagcggcaagctgcaacgttccgcctgccgcctgcgcctggaagacggc
agcctggacagctatgcgctgtttcccggcctccaggccgtgcaggaggcgcagccgccg
gcaggcgacgacgaactgctggcacgcatcggcgagatctggaaggcccggctgggcgtg
gcgcaggtagcgccgcgcgatcacttcttcctgcttggcggcaattccatcggcgccgcc
caggtggtcgcccaggtgcgcgacagtctcggcgtcgccctcgacctgcgccaactgttc
gaggcgccgaccctgcaggccttcagcgccacggtggcccgccaactggccgccggcctg
ccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgatccgcagagcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgcgacggcgcggccttg
cagcgtatcgacgagcggggcgagttcgcctggcagttcgtcgacctcgccgcgctggcc
gagcacgaacgcgccgcggctgccgcgcagcgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctggacgaacaggagcac
cagctctgggtcaccctgcatcacatcgtcgccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggcggccagccggccgacctggcgccg
ctggaactgcactacgccgagttcgctgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggagcgcctgggcgacacggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggctatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcggcctgcggccagggcggccagttgttccaggtgctgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcccggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaatttcgactacgccgcggacctcttcgacgaggccagcatccgg
cgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcacctcgccgaatggggcagc
gcgccctgcgagccggcgcgcgcctggctgccggagctgctggagcggcaactggcgcag
tccgccgaacgcgtcgccctggagtgggacggcggcagcctcggctacgccgaactgcac
gcccgggccaaccgcctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctgctggcgatcgtcaag
gcgggcggtgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagtggcgtcgagctgctactgacccaggcccatctgttcgaacgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacaactggccgagc
caggcaccgggcctgcacctgcacggcgacaatctcgcctacgtcatctacacctccggc
tccaccggccagccgaagggcgtgggcaacacccacgcggcgctggccgagcgcctgcaa
tggatgcaggccacctacaccctcgacggcgacgacgtgctgatgcagaaggcgccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctggtcaccggttgccggttggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
ggggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggc
gtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgaggcgcttccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccattggcagtgccgcgcggaagacggcgagcgttcg
ccgatcggccgaccgctgggcaacgtggtctgccgcgtgctggacgccgagttcaacctg
ctgccggccggcgtcgccggcgagctgtgcatcggcggcctgggcctggcccgcggctac
ctggggcgcccggcgctgagcgccgagcgcttcgtcgccgatccgttctcggccgccggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggccgcctcgaccagcaggtcaagctgcgtggcttccgcatcgagccggaggaaatc
caggcacgcctgctggcgcagccgggggtggcccaggcggtagtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgtcggcgccgaggcggaagcc
gagcagaaccagcgtctgcgcgccgcgctacaggccgaactgccggaatacatggtcccg
acgcagttgatgcgcctggcgcagatgcccctcggcccgagcggcaagctggatacgcgg
gcgctgccggagccggtctggcagcagcgcgagcacgtcgagccgcggaccgagctgcaa
cggcgcatcgccgcgatctggagcgaagtgctcggcctgccgcgggtcggcttgcgcgac
gatttcttcgagctcggcgggcattccctgctggccacccgcatcgtctcgcgcacccgc
caggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggccagcgaactggaggcc
ttctgcgaacaggtccgcgcagcccaggccgccggacgtaccgacagccacggcgcgatc
cgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctacaacgtcggcggcctggcacgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcgacggcgtgccggtacagcgcgtgcacggcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagccgccagcag
cacctgcagaccctcgccgacagcgaggcgcaccggcccttcgaccttgagagcgggccg
ttgctgcgggtctgcatggtgaagatggccgagcgcgagcactacctggtggtgaccctg
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgaactgggcgcgctc
tacgaggccttcctcgacgaccgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggagagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccagggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcggcgcttcaacgccgcccgcgggctgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgtatcggcgcg
ccggtggcgaaccgcatccgcccggagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacggacagatgagcgtcggcgagctgcttgagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcagccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgggcgaccaagttcgacctcaacctggaggtcaccgacctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcatcgcgcggatg
gccggacactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgcattgcc
gaattgccgctgttcgccgccgaggagcggaagcaactgctgctcgccggcacggccggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgcgtggcggccagcccc
caggccccggcgctgaccttcgcaggacagaccctgagctatgccgaactcgatgcccgc
tccaaccgtctggcgcgcgtcctgcgcagtcacggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggaatatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgtttgaggccctcggcgagctg
ccggcaggcgtggcgcgctggtgcctcgaggaggacggcccggcgctggacgccgaggac
cccgcgccgctggcagcgctgagcgggccgcagcaccaggcctacctgatctatacctcc
ggctccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagtgcttcggcatgcgcgccgaggattgcgaactgcacttctattcg
atcaacttcgacgctgccagcgagcgcctgctggccccgttgctgtgcggcgcccgcgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcaccccgagctacggcagccagctcgcccagtggctggag
agccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaagcgctgaccggc
gagcacctgcaacggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgagacggtggtcatgccgctggcctgcctggctcccgaacgactggaggagggt
gccgccagcgtgccgatcggcagcgtggtcggcgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgaactctacgtcggcggcgccggcctg
gcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgcctgtgcgacaacggc
caggtggaatatgtcggccgcatcgaccaccaggtgaagatccgtggcttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgag
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcatctcaagcagcaa
ttgccggactacatggtgccggcccacctgctgttgctcgccagcctgccgctgaccgcc
aacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcgctcaaccggcaggcc
tacgaggccccgcgcagcgtgctggagcagcaactggccggggtctggcgcgaggtgctg
aacgtcgagcgggtaggtctcggcgacaacttcttcgaactgggcggcgattcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccacttcagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggcgcgccgcgaacactggaaccaggcgctgctgttgcagccgcggcag
gccattgacctcggtctgctgcgcaagtccctgcaacgcctggtcgaacagcatgatgcc
ctgcgcctggcgttccgccaggtcgacggcgagtggctggcgcagcatcgtccgctgcgc
gaacaggaactgctctggcacgtcccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacaggggccgctgctgcgcgcggtgctggtg
gacggcccggccggtgagcaacgcctgctgctggcgatccaccacctggtggtggacggg
gtgtcctggcgggtgctgctggaggacctgcaacaggtctaccgtcagttcgccgagggc
gccgaaccggcgctgccggccaagaccagcgccttccgcgactgggccggacgcctgcag
gcctacgccggcagcgaatcgctgcgcgaggagctgggctggtggcaagcccggctgggt
gggcagccggtcgagtggccgtgcgaccgcccgcagggcgacaaccgcgaggcgctggcg
gaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccatcgacgctggtgcagttggaagggcatggccgcgaggcgctg
ttcgacgatatcgacctgacccgcagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgcccacggcgccgatcaccttcaactacctcggacagttcgac
cagagcttcgccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggcgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcggacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccctg
gcagtgccggccggcgagatcgaggacgtctatccgctgaccccgatgcaggaagggttg
ctgttacacaccctgctggaaccgggcaccggcatctactacatgcaggaccgctaccgg
atcgacagcccgctcgatcccgagcgcttcgccgctgcctggcaggcggtggtggcccgc
cacgaggcgctgcgtgcgtcgttcgtctggaatgccggcgaaacgatgttgcaggtgatc
cacaagcccggtcgcacccgcatcgagttcctcgactggagcgaactgccggaggacggc
cacgaggaacgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgacctgctc
gaacagccgccgttccacctgcgcctgatccgcctgggcgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatcgatgcctggtgccgtggcctgctgatgaacgacttc
ttcgagatctacagtgctctcggcgaaagccgcccggcgaacctgccgacgccgccgcgc
taccgcgactacatcgcctggctgcaacgccaggacctggagcaatcgcgacgctggtgg
agcgagagcctgcgcggcttcgagcggccgaccctggtgcccagcgaccgcccgttcctc
cgcgagcacgccggcgaaagcggcgggatgatcgtcggtgaccgctacacgcgtctggac
gccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccagctcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctg
ttcggcgtcaccgtggccgggcgcccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcagatgccggccgccggccagcgctgcacg
gtacgcgaatggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtagccatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgctccggtggaagtctcggtactggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgttgaccgtggtctgc
tatccgggtgatgacctcggcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accgtcgagcgcctgcttggcgagttcaagcgcctgctgctggccctggccgacggtttc
cacggcgaactggaggccttgccgctgctcggcgaggacgagcgcgacttcctcctcgac
ggctgcaaccgcagcgcccgcgactacccgctggagcaaggctacgtgcggctgttcgag
gcgcaggtggcggcccatccgcagcgcatcgccgccagttgcctggaacagcgctggagc
tacgccgagctgaaccgccgggccaaccgcctcggccacgccctgcgcgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccccggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacactggtactggtctgcacccaggcctgc
cgcgagcaggcgctggcgctgttcgacgaactcggctgcgtcgaccggccgcgcctgctg
gtgtgggacgagatccagcagggcgagggcgccgagcacgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttcctcgccgcgccgttgttcggcgcccgcgtggcgatcgtgccgaacgccgtcgcccac
gatccgcagggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcgctgatccagggcatgctcgccgaagagcgccaggccctcgacggcctgcgctgg
atgttgcccaccggcgaggcgatgccgccggaactggcgcgccagtggctcaagcgctac
ccacggatcggcctggtgaatgcctacgggccggcggagtgttccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggtgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggtcgtggctacgtcggcgat
ccgctgcgcaccgctcaggccttcgtcccgcatccgttcggcgcgccgggcgagcgtctg
taccgtaccggcgacctggcgcggcggcgcgccgacggggtgctggaatatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtccaggaaggggcgaacggc
aagtacctggtgggctacctggttcccggcgagacaccgcgttccagcgccgactcgccg
gccggactgatggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggaccggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggacatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcgcggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggcgggcattcg
ctgctggccacccagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcaccacggtggaagagctggccagctacatcgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system