KEGG   Pseudomonas aeruginosa PAO1: PA4095Help
Entry
PA4095            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PA4095
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PA4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-GeneID: 878729
NCBI-ProteinID: NP_252784
UniProt: Q9HWT3
LinkDB All DBs
Position
4577650..4578183
Genome map
AA seq 177 aa AA seqDB search
MPELATREFWKDLQPIPDCFKPDAKPEVYLRNAPTEDERLYVPFTETVKSRPLWISPSEN
RWCDILMATSAGLVNRHYHPHEVFAYTISGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLVWLDEKGNADGIFDVHDYIAMCREHYDKIGVGAAYIDSLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactcgccacccgtgaattctggaaagacctgcaaccgattcccgactgcttc
aagccggacgccaagcccgaggtctacctgcgcaacgcgccgaccgaggacgagcgcctc
tacgtgcccttcaccgagaccgtgaagtcgcgtccgctgtggatctcgccaagcgaaaac
cgctggtgcgacatcctgatggcaacgagcgccggcctggtcaaccgccactaccacccg
cacgaggtgttcgcctacaccatcagcggcaagtggggctacctggagcacgactggacc
gccaccgccggcgacttcgtctacgagacgcccggcgagggccacaccctggtggcctac
gagcacgagcagccgatgcgtgcattcttcatcgtcaagggaccgctggtctggctcgac
gagaagggcaacgcggacggcatcttcgacgtccacgactacatcgcgatgtgccgtgag
cactacgacaagatcggcgtcggcgccgcctacatcgactccctgttccgctga

DBGET integrated database retrieval system