KEGG   Pseudomonas aeruginosa PAO1: PA4098Help
Entry
PA4098            CDS       T00035                                 

Definition
(RefSeq) short-chain dehydrogenase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind Oxidored_nitro GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-GeneID: 878798
NCBI-ProteinID: NP_252787
UniProt: Q9HWT0
LinkDB All DBs
Structure
PDB: 

Position
4580583..4581308
Genome map
AA seq 241 aa AA seqDB search
MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWID
TPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccaacacgatatctacgccggccagcaggtactggtcactggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggacgccgacggcgtgcacgcaccgcgtcatccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagcgctgccgcgcctggatgtg
ctggtgaacaacgccggcatcagccgcgaccgcgaggaatacgacctggctaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccaactggcccggccgctg
ctggcgcagcgcggcggcagcatcctcaacatcgcctcgatgtacagcaccttcggttcc
gccgaccgcccggcctacagcgccagcaagggcgccatcgtccagctcacccgttccctg
gcctgcgagtatgccgccgagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgtcgaggccacccgccggatcatgcagcgc
acgccgctggcgcgctggggcgaggcgcccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctatctctgc
gcctga

DBGET integrated database retrieval system