KEGG   Pseudomonas aeruginosa PAO1: PA4111Help
Entry
PA4111            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r1_2
Motif
Other DBs
NCBI-GeneID: 877888
NCBI-ProteinID: NP_252800
UniProt: Q9HWR9
LinkDB All DBs
Position
4595287..4595685
Genome map
AA seq 132 aa AA seqDB search
MSASPPLRQPCPPGACVCERERLEAPGADRRILLLTRQEEQRLAARLEALRSLEDLEHLL
RRMEEQLGIRLRIAPAFGEVRSMRGIRMRFEEQPGLCRKTRQAIPAAIRRGLEKRPEVAY
ALLNAHDLLRDA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttccccgcccctccgccagccctgcccgcccggcgcctgcgtctgcgaacgc
gagcgcctggaggcgcccggcgcggaccgtcgcatcctcctcctgacccgccaggaagag
cagcgcctggccgctcgcctggaagccctgcgcagcctggaagacctggaacacctgctg
cggcgcatggaggaacaactgggcatccgcctgcggatcgccccggccttcggcgaggtg
cgcagcatgcgcggcatccgcatgcgcttcgaggagcagccggggctctgccgcaagacc
cgccaggcgattcccgccgccatccgccgcggcctggagaagcgcccggaagtcgcctac
gccctgctcaacgcccatgacctgctgcgcgacgcctga

DBGET integrated database retrieval system