KEGG   Pseudomonas aeruginosa PAO1: PA4201Help
Entry
PA4201            CDS       T00035                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00473  D-Alanine metabolism
pae00550  Peptidoglycan biosynthesis
pae01100  Metabolic pathways
pae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA4201 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA4201 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PA4201 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pae01011]
    PA4201 (ddlA)
Enzymes [BR:pae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA4201 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pae01011]
 Precursor biosynthesis
  Amino acid ligase
   PA4201 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-GeneID: 879033
NCBI-ProteinID: NP_252890
PathoGenesis: PA4201
UniProt: Q9HWI0
LinkDB All DBs
Position
complement(4700906..4701946)
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEEVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggctttgcgcagcgccggccaccaggtg
ctggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggctggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctgcaggcgctgctggatgccggtggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggag
gtgcgcgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggccatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggcggccaggaggtcttcgac
tacgagcacaagtaccaggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgcctggaggtc
aataccctgccgggcatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
atcggtttcgccgaactctgcgagcggatctgccggctcggcatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system