KEGG   Pseudomonas aeruginosa PAO1: PA4366Help
Entry
PA4366            CDS       T00035                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PA4366 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 881397
NCBI-ProteinID: NP_253056
PathoGenesis: PA4366
UniProt: P53641
LinkDB All DBs
Position
4893697..4894278
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgcccttgagccgcacatttcc
gcagaaaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctgatcccgggcaccgagttcgaaggcaagagcctcgaagagatcgtcaagagctcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggccagcccaccggcgccctggccgacgccatcaacgccgcc
ttcggctccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtagcgaagaatttcgctgcctga

DBGET integrated database retrieval system