KEGG   Paenibacillus sp. FSL R7-0273: R70723_04815Help
Entry
R70723_04815      CDS       T03356                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    R70723_04815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paea03400]
    R70723_04815
Enzymes [BR:paea01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     R70723_04815
DNA repair and recombination proteins [BR:paea03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     R70723_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIQ45293
UniProt: A0A089KEC0
LinkDB All DBs
Position
complement(1080680..1081627)
Genome map
AA seq 315 aa AA seqDB search
MDLKPVKPFEPMLAAQLPAGSQWIAQIKWDGVRMLSYYDGGPIELVNRRGNRRTMQYPEL
TAEGRYCRADSYILDGEVIALSGGKPSFHEVMRRDGVRSEAAVRAVQPQVPVLYMVFDIL
YCNGEWLLDRPLSVRQQILRDVLLPHPHVQNVPSYSDPAQLFAAACSGGLEGIICKDTGS
TYAPGGKDARWLKRKNILDVTAVAGGVTFRDGIVNALLLGLYDDEGRLHYIGHAGAGRMT
AADWRNLTAQAHSLALPSSPFAAMPERSKDAVWISPTLVFKLHFLEWNPSGTLRQPVIQA
QVDLPPDACRLEQRG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaagccggttaagccattcgagccgatgcttgctgcacagcttcctgccggc
agccagtggatcgcgcagattaaatgggacggtgtccggatgctctcttattatgacgga
ggccccatagagcttgtaaaccgccggggcaaccggcgcacaatgcagtatcccgagctg
acggcagagggacgttactgccgcgcagacagctatattcttgacggtgaggttattgcc
ctgagcggggggaagccgtcctttcacgaggtgatgcggcgtgacggcgtaagaagcgaa
gcggctgtccgggcggtacagccgcaggttccggtgctgtatatggtattcgatattctg
tactgcaacggtgaatggctgctggaccggccgttgtccgtacgccagcagatcctgcgg
gacgtgctgctgccccacccccatgtgcagaatgtgccgagctattcagatcctgcacag
ctgttcgccgctgcctgcagtggagggctggagggcattatctgcaaggatacaggcagc
acctatgctccgggcggcaaggatgcgcgatggctgaagcgcaagaacattctggatgtg
accgctgtagccggaggggtcaccttccgggacggcatcgtgaatgccctgcttctcgga
ctgtatgacgatgaaggcaggcttcactacatcgggcatgccggggctggaagaatgacg
gcagcagactggcgtaatctcactgcgcaggcgcacagcctggccctgccgtcatcgccc
tttgcagccatgccggagcgcagcaaggatgcggtgtggattagccccaccctggtgttc
aagctgcattttctggagtggaacccgtccggcacactgcgccagccggttatccaggcg
caggtggatctgccgccggatgcctgccggctggagcagcgcggctga

DBGET integrated database retrieval system