KEGG   Paenibacillus sp. FSL R7-0273: R70723_05510Help
Entry
R70723_05510      CDS       T03356                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00473  D-Alanine metabolism
paea01100  Metabolic pathways
paea01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paea00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    R70723_05510
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    R70723_05510
Enzymes [BR:paea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     R70723_05510
Peptidoglycan biosynthesis and degradation proteins [BR:paea01011]
 Precursor biosynthesis
  Racemase
   R70723_05510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PAAR_motif Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AIQ45415
UniProt: A0A089KCH0
LinkDB All DBs
Position
1233037..1234218
Genome map
AA seq 393 aa AA seqDB search
MQASYRPTVAEINLDDLRTNYEAFRAALPAETKFMGCVKGNAYGHGAVEVTRELERLGAD
YVSVAFLDEALELRQAGILLPILVLGYTSPEGIAVAWENKITVTLFTPEVLEAVRQLPAD
PEHRLKVHIKIDSGMGRLGLLPADASAFIEEVHRTAQAELEGMFTHFAKADEEDKSYTLM
QHRRFMSVAETLRDKDIHIPIIHTGNSATAIDTPFLSSNMVRVGISLYGFYPSTEVDHER
VALHPVMTLKTQAVYIKTLPPGFGISYGTRYFTDSEEVIATLPVGYADGYSRMLTGKAEV
LIRGRRAPVVGTICMDQCMVTLKSFAGEAEQIQAGEEVVLIGRQGNACITADELALHLGT
IHYEVICMLAHRVPRVYVREGADPNLVNPLLQS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcaagctatcgacctacagttgccgagataaatctggatgatctgcgtaccaat
tatgaagcgttccgggcggctttgccggcggaaacgaaattcatgggatgcgtcaaagga
aatgcgtatggccacggggcagtggaagtgacacgggagcttgaacggctaggcgcggac
tatgtaagtgtagcttttttggatgaggcattggagctgcgtcaggcgggaatactactt
cctatcctggtgctgggctatacctcaccggaaggcatagccgttgcctgggagaacaag
ataaccgtaacgctattcacgccggaggtgctggaggcggtaagacagcttcctgccgat
ccggagcaccggctgaaggtacacatcaagattgacagcgggatgggaaggctgggactg
ctgccggccgatgcttccgctttcatcgaagaggtgcaccggacagcgcaggcggagctg
gagggcatgtttacccattttgccaaggcagacgaagaagacaaaagctatacactgatg
cagcaccgacggttcatgagcgtggcggaaacgcttcgggacaaggatatacatatcccg
atcatacatacgggcaatagcgctacggccattgatacacctttcctatccagtaacatg
gtgcgtgtaggcataagcttgtacggattttatccctcaacagaggtagaccacgagcgc
gtggctttacacccggtaatgacgctgaagacacaggcggtatatatcaagacactgccc
cctgggtttggcatcagctacggcacccgctatttcacggacagcgaagaggtaattgcg
acgctgcccgtcggatacgcagacggatattcccgcatgctgactggcaaggcggaggtg
ctaatacgcggacgccgcgctccggtcgtcggaacaatctgcatggaccagtgtatggta
acgctcaaatctttcgctggagaagcggaacaaatccaagctggcgaagaggttgtactc
atcgggcgccagggcaacgcctgcattacggcggatgaactggcactccatttaggcacg
attcactacgaagtaatctgtatgctggctcaccgtgtaccccgcgtatatgtacgtgag
ggtgctgatcccaacctggtgaaccctctgctgcagtcttga

DBGET integrated database retrieval system