KEGG   Paenibacillus sp. FSL R7-0273: R70723_07190Help
Entry
R70723_07190      CDS       T03356                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00010  Glycolysis / Gluconeogenesis
paea00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R70723_07190
   00500 Starch and sucrose metabolism
    R70723_07190
Enzymes [BR:paea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     R70723_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ45695
UniProt: A0A089KD42
LinkDB All DBs
Position
complement(1558417..1559829)
Genome map
AA seq 470 aa AA seqDB search
MTVKFPENFLWGGAVAANQLEGAYNEDGKGLSTQDVAPQGIKGPITEAPTEDNMKLVGID
FYHRYKEDIKLFAEMGFKVFRTSIAWTRIFPNGDELEPNEKGLQFYDDLFDECRKYGIEP
LVTISHYETPLHLSKQYNGWVNRDLVGFYERYARTLFTRYKGKVKYWLTFNEINSILHEP
FMSGGIYTPKDQLSKQDLYQAIHHELVASATAVKVGHEIDPEAQIGCMILSMPTYPLTPN
PDDVIAAMKSEHMNYFFGDVHARGVYPGYMKRYFRENGIEIHMEPEDAEILKHTVDFISF
SYYVSICETGDDSSRKQTEGNLFSGAANPYLEASEWGWQIDPQGLRYVLNMFYDRYQKPL
FIVENGLGAKDVLITGEDGVPTVNDDYRIKYLNDHLVQVGEALEDGVEIMGYTAWGCIDL
VSASTAELSKRYGFIYVDRHDDNTGTLERYRKKSFHWYKEVIATDGQSLK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaatttcctgaaaactttctgtggggcggcgcagtagcagccaaccagctg
gaaggcgcatataatgaggacggcaaaggcctgtccacccaggacgtggctccgcaaggc
attaaagggccaatcaccgaagcacctaccgaagataatatgaagctggtcggcatcgac
ttttatcaccgctataaggaagatatcaagctttttgctgagatgggcttcaaggtattc
cgtacctccattgcctggacgcgcatcttcccgaacggggacgagctggagcctaacgaa
aaaggcctgcaattctacgacgacctgttcgacgaatgccgtaaatacggcattgagccg
ctggtgaccatctcccactacgagacaccgctgcacctgtccaagcaatacaacggctgg
gttaaccgtgatctggtcggcttctatgagcgttatgccagaacgctgttcacccgctac
aagggcaaagtgaagtattggctgacttttaacgagatcaactccattctgcatgaaccg
ttcatgagcggcgggatttatactcctaaggaccagttaagcaagcaggacctgtatcag
gccatccatcatgagctggtagccagtgcaacggctgtcaaagtcggacacgaaatcgat
cccgaagcccaaatcggctgcatgatcctcagtatgcctacttacccgctgactccgaac
cctgacgatgtgatcgcagcaatgaagtccgagcatatgaactacttcttcggcgatgtg
catgcgcgcggcgtataccctggctatatgaaacgttacttccgtgaaaatggcatcgag
attcatatggagccggaagatgcagaaatcctgaagcacacggtagactttatctctttc
agctactatgtaagcatctgcgaaaccggcgacgacagcagccgcaagcagacggaaggc
aacctgttcagcggtgcagctaacccgtacctggaagcaagtgaatggggctggcagatt
gacccgcagggtctgcgttatgtgctgaacatgttctacgaccgctaccagaaacctttg
tttatcgtggaaaatggacttggcgccaaggacgtgctgattacaggcgaagacggcgtg
ccgacggttaacgatgattaccggatcaaatatttgaatgaccacctggtgcaggtaggc
gaagcgctggaggacggcgttgagattatgggctacactgcatggggctgtatcgacctg
gtcagcgcatcgacggcagagctcagcaagcgttacggcttcatttatgtggaccgacac
gacgacaacacaggtacgcttgagcgttaccgcaagaaatccttccactggtacaaagag
gttattgctactgacggccagagcctgaagtaa

DBGET integrated database retrieval system