KEGG   Paenibacillus sp. FSL R7-0273: R70723_12160Help
Entry
R70723_12160      CDS       T03356                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00052  Galactose metabolism
paea00511  Other glycan degradation
paea00600  Sphingolipid metabolism
paea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paea00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    R70723_12160
  Lipid metabolism
   00600 Sphingolipid metabolism
    R70723_12160
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    R70723_12160
Enzymes [BR:paea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     R70723_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AIQ46540
UniProt: A0A089KFJ0
LinkDB All DBs
Position
2754030..2756417
Genome map
AA seq 795 aa AA seqDB search
MNNGTGRSKVQFDGEWSFYKGDIRIPYAVKAGMTGGITDASTRKDGEWLDIAFNDKGMGE
QQLDWSSVSIPHDWCVEQQYVQDEHLGARDGSHGYLPGGIGFYRKGFELPAEAAGSKWLI
RFDGVSGTSTVWVNGHLIGSHHGGYIGFSYDLSDVLRYGDEGSNVIVVKVDATECEGWWY
EGCGIYRHVWLENMDLLHVAEYGTYITTPEVAKEQATVNIRTRIRNQYTEGLQVSLQTVI
YDGSGQQVCAWSADTYAEWYAETELAQSFVVQQPNLWGPDSPYLYRAESVIIHEGKELDR
YETVFGIRSIRFDAEEGFFLNGEPLVIKGTCNHQDFAGVGVALPDSLIEYKLKLLQEMGS
NAYRSAHHPPTPELLDICDRIGMLVMDENRKLDSSPNGISQLERLLYRDRNHPSVIIWSM
ENEEVLEGTITGARILKTLADTTRRIDPTRPTCAAMNHGWNENGYNDAVEITGYNYGHRD
HLDIRDHEQYPGRLMIGSECASFTATRGVYEDDPVRGYCSEYGTNIPSWGCTPQQAWRDL
VDNRFLTGVFMWTGFDYRGEPTPYLWPCINSHFGLMDTCGFPKDSYYYMQAVWTEKPMVH
LLPHWNWPGSEGKPVEVRVFSNTGTVELYLNGRSLGEQQVDRNGYLTWNVIYEPGQLEAV
GKHGGQEVARKSVVTAGQPHQIQLIPDRHEARADGMDTIPVRVAVLDKDGNIVPTADNEI
RFEVTGAGSLLGVGNGNPSSHEPDKSSLRRAFNGWCLALVQASGDAGSVTLRAESLGLAP
AELMLQTVPGDHIEV
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaataatggcacaggcagaagcaaagtacagtttgacggggagtggagcttttataaa
ggggatatccggattccctatgcagttaaggccgggatgacaggcggaataacagatgca
agtacccgcaaggatggggaatggctggatattgcattcaacgataaaggaatgggcgag
cagcagctggactggtcttctgtcagcatcccgcatgactggtgtgtggagcagcagtat
gtccaggatgagcatctgggagccagagacgggagccacgggtatttgccgggcgggatc
ggtttttaccgcaaggggtttgagctgccggccgaggctgcgggaagcaaatggctgatc
cgttttgacggggtatccggcaccagcacggtatgggtgaatggacatctgatcggcagt
caccatgggggatacatcggcttcagctatgacctgtcggacgtgctccgttacggggat
gagggcagtaatgtcattgttgtcaaagtggatgcgacggaatgtgaaggctggtggtac
gagggctgcggcatttaccggcatgtctggctggagaatatggatctgctgcatgtggcg
gaatacggtacgtacataaccacacccgaggttgccaaagaacaggcaacggttaacatc
cgcacacggatccgcaatcaatatacagaaggtcttcaggtctccctgcagaccgtaatt
tatgacggctccgggcagcaggtctgtgcatggtcggcagatacctatgctgagtggtac
gccgagacggagcttgcgcagagcttcgtggtccagcagcctaacctttggggacctgat
tcaccgtatttgtacagagcagaatcggtaataatccatgaaggaaaagagctggaccgg
tacgagacggtgttcggcatccgcagcatccgttttgatgcggaggagggctttttcctg
aacggtgagccgctggttattaaaggaacatgcaatcatcaggattttgccggagtcggc
gtggccttgccagatagcctgattgaatataagcttaagcttctgcaggagatgggctcc
aatgcttaccggagcgcacatcatccgccaaccccggagctgctggatatctgcgaccgg
atcggaatgctggtgatggatgagaaccgcaagctggacagcagcccgaacgggattagc
cagctggaacggctgctctaccgtgaccgcaaccatccgagcgtcattatctggagcatg
gagaatgaagaggtgctggaaggcaccatcacaggcgcccggatactgaaaacactggcg
gacaccacccgccgcattgatccgacacgcccgacctgtgctgcaatgaaccacggctgg
aacgagaacggctataatgatgcggttgaaattaccggctataattatgggcaccgggac
catctcgatatccgtgaccatgagcaatacccgggacgcctgatgattggcagtgaatgt
gccagctttacagcaaccagaggcgtgtatgaggatgatccggttagaggctactgctcc
gaatacggcacgaacattccttcatggggctgcacgccgcagcaggcctggagagatttg
gtggacaaccgctttttgaccggtgtcttcatgtggaccggatttgattaccggggagag
ccgactccgtacctgtggccgtgcatcaattcccatttcggtctgatggatacttgcggt
ttcccgaaagacagctattattatatgcaggctgtgtggacagagaagccgatggttcat
ctgctgccgcactggaattggccgggctcggagggtaagcctgttgaggttcgcgtgttc
tctaataccgggactgtggagctatatctgaacggcagaagcctgggagaacagcaggtg
gacagaaacggatatttgacctggaacgtgatctacgagccgggacagctggaggctgtc
ggaaagcacggcggacaggaggtagcccggaagtctgttgtgacagccggccagcctcat
cagattcaactaattcctgaccggcacgaagcacgggcggacggaatggatacgattcct
gtccgcgttgctgtactggacaaggatggcaatattgtgcctacagccgataacgaaatc
cgttttgaggttaccggtgcaggctccttgctgggcgtaggcaacggtaacccaagcagc
catgagccggacaagtcgtccctgcgccgtgcctttaacggatggtgcctggcgctggtt
caggcctccggcgatgcaggctctgttacgctgcgggccgaatccttaggacttgctcct
gcagagctgatgctgcagacggtaccgggagatcatatagaagtataa

DBGET integrated database retrieval system