KEGG   Paenibacillus sp. FSL R7-0273: R70723_23115Help
Entry
R70723_23115      CDS       T03356                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R70723_23115
Enzymes [BR:paea01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     R70723_23115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 Thi4 DAO Glutaredoxin K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIQ48482
UniProt: A0A089KJ94
LinkDB All DBs
Position
5125025..5126554
Genome map
AA seq 509 aa AA seqDB search
MALDADIKAQLAQYLQLMEGEVLLKVSAGDDSVSQEMLSLVNELAEMSANIKVEHTALPR
TPSFSVNRPGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKAEQATIDQIKGLKGEYHF
ETYISLTCHNCPDVVQALNLMSVLNSGVTSTMIDGAAFKSEVESKDVMAVPSVYLNGEFF
GSGRMTAEEILAKLGTGPDASELSDKAPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMETMGIENFIGTKYTEGPKLAASLEEHVKEYEIDVMKTLRAKRLEKKELIEIELE
NGAVLKSKTVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKHVAVIGGGNSGI
EAAIDLAGIVSHVTVLEFMPELKADSVLQKRLYSLPNVTVHKNVQTKEITGTDKVNGITF
IERDTGTEQHVELEGVFVQIGLVPNTDWLADSLERTRFGEIVVDSHGATSIPGVFAAGDC
TNSPFKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgatgcggatatcaaagcacaattagcgcagtatcttcagctcatggagggc
gaggtactgctgaaggtcagcgccggagacgacagcgtttcgcaagaaatgctgtctctg
gtgaatgagctggccgaaatgtcggccaatatcaaagtagaacatactgcacttccgcgc
acgccaagcttcagcgtgaatcgtccgggcgaagataccggcgttacctttgctggcgta
ccgctcggccatgaattcacctcactggtgctggccctgctgcaggtaagcggcagagct
ccaaaggcggagcaggcgactattgatcagatcaagggcctcaagggtgaataccacttc
gagacctatatcagcctgacctgccacaactgcccggatgtggtacaggcgctcaacctg
atgagcgtacttaacagcggcgtaaccagtactatgatcgatggtgctgctttcaagagc
gaagttgagagcaaggatgttatggcggtaccgtccgtctacctgaacggcgagttcttt
ggcagcggccggatgaccgcggaagaaattctcgctaagctgggtaccggaccggatgct
tccgaattatccgacaaggcaccatttgatgtactggtggttggcggcggtcctgccggc
gcgagtgcggctatctatgccgcccgtaaagggatccgcaccggtatcgtcgctgagcgc
ttcggcggccaggttatggagacgatgggcattgagaacttcatcggtacgaagtacacc
gaaggtccgaagctcgctgcgagcctggaggagcacgtgaaggaatacgagatcgatgtg
atgaagactctgcgggccaagcgcctggagaagaaggaactcatcgaaatcgagctggag
aacggtgccgtgctgaagagcaagacggttatcctctctactggcgcccgctggcgtaat
gtgggggttccaggcgaagccgagttcaagaacaaaggcgtagcgtactgcccgcactgt
gacggcccgctcttcaccggcaagcatgttgccgtaatcggcggcggcaactccggtatc
gaagcggcgattgacctggcgggtatcgtcagccatgtaaccgttctggaattcatgcct
gagctgaaggcagactctgtgcttcaaaagcgtctgtacagcctgcctaacgtaaccgtg
cataagaacgttcagaccaaggaaattacaggcactgacaaggtgaacggcattaccttt
atcgaacgcgacaccggtacggagcagcatgttgagcttgaaggtgtattcgtccaaatc
ggccttgtgccgaacaccgactggcttgcggattcactggagcgtacccgcttcggcgaa
atcgtcgtcgacagccacggtgcaaccagcattccgggtgtgttcgccgcaggcgactgc
accaacagcccgttcaagcagatcatcatctccatgggctccggcgcaaccgccgccctg
ggtgcattcgattatctgatccgcaattaa

DBGET integrated database retrieval system