KEGG   Paenibacillus sp. FSL R7-0273: R70723_25490Help
Entry
R70723_25490      CDS       T03356                                 

Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paea03016]
    R70723_25490
Enzymes [BR:paea01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     R70723_25490
Transfer RNA biogenesis [BR:paea03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    R70723_25490
 Prokaryotic Type
    R70723_25490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT 3-PAP
Motif
Other DBs
NCBI-ProteinID: AIQ48890
UniProt: A0A089KM80
LinkDB All DBs
Position
complement(5692172..5693308)
Genome map
AA seq 378 aa AA seqDB search
MAAITYEHIKTCKQSGARLGRVHTPHGIIETPTFMPVGTQATVKTMAPEELKQMDAQIIL
SNTYHLFLRPGHDIVREAGGLHKFMNWDRPILTDSGGFQVFSLSDMRKITEEGVHFRSHL
NGDKKFLSPEVAMEVQNALGSDIMMAFDECPPYPAEYDYVKKSLERTTRWAERCLKAHAR
PEDQGLFAIVQGGMYEDLRRQSAADLTSMDFPGYAIGGLSVGESKQIMYDVLDYTLPLLP
QNKPRYLMGVGSPDALLEGSIRGVDMFDCVLPTRIARNGTTMTSQGRLVVRNAQYARDFG
PLDPECSCYTCRNYSRAYLRHLIKADETFGLRLTTYHNLQFLLDLMRKVREAIREDRLLD
FRDEFFAQYGLYDNLKGF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaataacgtatgaacacattaagacctgcaagcagtccggagcacggctgggc
agagtccacacaccgcacgggattatcgagactccgacctttatgccggtaggcacacag
gcaactgttaaaacgatggcaccggaagagctcaagcagatggatgcccagattattctg
agcaatacgtatcacctgtttctgcgtccgggccacgatattgtacgcgaggccggcggc
ctgcacaaattcatgaactgggaccgtccgattctgactgacagcggcggctttcaggta
ttctcgctcagcgacatgcgcaaaatcaccgaggaaggcgtgcatttccgctcccacctc
aacggggacaagaagttcctctcaccggaagtggcgatggaggttcagaacgcgctcggc
tccgatattatgatggcatttgacgagtgcccgccatacccggcagagtatgattatgtc
aaaaaatcgctggagcgcacaacgcgctgggcagaaagatgcctcaaggctcacgcccgt
ccggaggaccaggggttgtttgcaatcgtacagggcggcatgtatgaagacctgcgccgt
cagagtgcggctgatttgacttccatggatttcccggggtatgctattggggggcttagt
gtcggcgaatccaagcagattatgtatgatgtgctggattatactttaccgctcctgccg
cagaacaaaccgcgttacctgatgggcgtcggttcaccggatgcgctgcttgaggggtca
atccgcggagtggacatgttcgactgtgtcctgcctacccgtatcgcccgcaacggaacc
acgatgaccagccagggcagacttgttgtgcgcaatgcacaatatgcccgcgacttcggg
ccgcttgatccggagtgcagctgctacacctgccggaattattcccgtgcatatttgcgt
catctgatcaaagccgatgaaacgtttggcctgcgcttaacgacttaccacaacctgcag
ttcctgctggatttgatgcgtaaggtacgggaagcgatcagagaagaccggctgcttgat
ttccgtgatgagttttttgcacagtacggtttgtatgataatctcaaaggcttctag

DBGET integrated database retrieval system