KEGG   Paenibacillus sp. FSL R7-0273: R70723_25570Help
Entry
R70723_25570      CDS       T03356                                 

Definition
(GenBank) hypothetical protein
  KO
K06318  forespore regulator of the sigma-K checkpoint
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    R70723_25570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofC_C
Motif
Other DBs
NCBI-ProteinID: AIQ48903
UniProt: A0A089KPQ8
LinkDB All DBs
Position
complement(5710618..5711385)
Genome map
AA seq 255 aa AA seqDB search
MNAFRLKKQLWRRWRRWKNAPWVGAACIVLSVLAWRGMQVPEELSRLLSTNEWNMPAEAS
TFYDPLQNGDQDSSVAALAAVRQNAGDTGEDGGLKPRRAKLLETVSAEGISRIVHLKTVY
VTGEEIQTLSGLKTPGQLKGLIEDRPGWSGWISAEGDLWLEKRVNDLSPLTKQNAYIGVD
EEGNLSLFKGRPEGEEVLKTFFQMDMGSMKSSLPEEVWKQLHDGIRVQDIEEYNSVLSTF
SDYARDSAEQVMQAE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcttttcgcttgaaaaaacaactgtggcggcggtggagacggtggaagaatgcc
ccttgggttggagcggcctgtattgtattatcggtgcttgcctggcgggggatgcaggtt
ccggaagagctaagcagactgctcagcacgaacgaatggaatatgccggcggaagcaagc
acattctatgatccgctgcagaacggagatcaggacagcagtgtggcggcactggcagct
gtccggcagaatgccggtgacaccggggaagacggcggcctgaagccccggcgtgccaag
ctgctggagacagtaagtgccgaggggatcagccggattgttcatctgaagacagtctac
gtcaccggtgaggagatccagacgttgtccggcctgaaaactcccgggcagctaaaggga
ctgattgaggaccgccccggctggagcggatggatcagcgctgagggcgatctgtggctg
gagaagcgggtaaatgacctgtcaccgctgaccaagcagaatgcctacatcggagtcgat
gaagagggcaatttgagcctgttcaagggccggccggagggggaagaggtgctgaagacc
ttttttcagatggatatgggctcgatgaaatcctcacttcccgaagaggtgtggaagcag
ctgcatgacggcatacgtgtgcaggatatcgaggaatacaacagtgtgctctcgaccttc
agtgactatgcgcgggattcggctgaacaggttatgcaggcagaatag

DBGET integrated database retrieval system