KEGG   Paenibacillus sp. FSL R7-0273: R70723_31600Help
Entry
R70723_31600      CDS       T03356                                 

Definition
(GenBank) histidine kinase
Organism
paea  Paenibacillus sp. FSL R7-0273
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c His_kinase Response_reg HATPase_c_2 HisKA HATPase_c_5 HATPase_c_3 7TMR-DISM_7TM OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AIQ49920
UniProt: A0A089KQ53
LinkDB All DBs
Position
complement(7076780..7079869)
Genome map
AA seq 1029 aa AA seqDB search
MRKYWLSVLASLLLVCSVPLFSILQNVMVTQDKPVSRQGIIDLRQWDFHRDGELELDGEW
EFYRDRLLTPADFRLPAADQNAPPVPNIINVPEKWNTYLSDDGTSQAKGYATYRLQAIIP
EGDAVVYGLRALNIRMASKIYLNGQMIGNSGYPASEPSESKANNIPYMGFAAVDGGRLEI
IVQVANYNYSSGGIIQPIIIGDQKSIMKHREFALFVDGATILGFFALALFLLMFSKVKAS
RGITLYLGLFSIGALIYILTHGEKLIAAALPGLPYEIVLKLQLASSTLVYYYLLRYVANS
VNYPMPQAVMKASRAITAVLLMIAVFIPAQYFSYLEGMLLTWGVVAISFVLYSMIAGTLQ
NRKNRFLMMVSIESLSVVIIFYLVSFSSAPFHYYVLSYEIILFGFVQAILMTRQYAASFL
EVEQLSRRLLTLDGLKDDFMAATSSELRMPLQGIVNIAQTLTEGAAGRLNAQQSGQLSMI
VSTGKRLSALINDMADFAKLNHGGLFLQRQAVDLHSVASSVIEVTRHVTGNPKLSFRLEL
PDTLPLLETDEQRLGQILFNLLANAVNYTQQGVITVSAEVKEDYVVIQVADTGSGMPPER
LRTIFDAYDPQGASAQKLYRENGLGLSITQKLVELNGGEIEGQSILGQGTRFRFTLPVLK
DPAAFLDQSYMEVTGWETAASSETAYNELGLLLDAECCKILVVENDPVNQQVLSNILKLE
RHLVITAASGPEALLIMQEQPDIDLVIMDWAIPEMPGLVLCQAIRERFVLSELPILVLTA
GNRPEDIQAIFEAGANDYLIQPVELREFRARVQTLLDMRKLIRKSVETEIAFLQAQIKPH
FLYNALNAIISVCPDDPDKATDLLLDLSMYLRSSFDFQNRGQTVPVEKELELVRSYLALE
KARFDDRLNIEFDLPERIRELIPPLSIQPIVENAVNHGLMQKEAGGTVTLSIRLLDRQLV
VAVSDDGIGMTQDRIGEVLSEERTEGGIGLRNIQRRLLKIYGTGLIIESVPGAGTRISYA
IPRTHPVSE
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatattggcttagtgtgctggccagcctgctgctggtctgcagcgtcccgttg
ttctccatccttcagaatgtgatggttacacaggataagccggtctccaggcaaggcata
attgatctgcggcaatgggattttcaccgggacggggagctggagctggacggggaatgg
gagttttaccgtgacaggctgcttacgcctgccgatttccgtctgcctgctgcagaccag
aacgctccgccagtaccgaatataatcaacgtgcctgagaaatggaatacatacctgtcg
gatgatggtacgagccaggccaagggctatgcgacgtaccgtctgcaggccattattcct
gaaggcgatgcagtcgtatacggcctacgggcacttaacatccggatggcaagcaaaatt
tacctgaacgggcagatgatcggcaacagcggctatccggcatccgagccctccgagagc
aaagccaacaatattccttacatgggatttgccgctgttgacggaggcaggctggagatt
atcgtgcaggtggctaattacaattattcttccggcggtatcatccagccgattatcatc
ggggaccagaagtcgattatgaagcaccgggaattcgccttgtttgtggacggggcaacc
atcttgggattttttgccctggccctgttcctgcttatgttttccaaggtcaaggcaagc
aggggaatcacgctctatctggggttgttcagtataggagccctcatatatatcctgacc
cacggtgaaaagctgattgctgccgcattgcccggcctcccctacgagatcgtgctgaag
cttcagctcgcttcttctacactggtctattattatctgctccgatatgtggcgaattcg
gttaactatccgatgccgcaggcagtaatgaaagcctccagggctattacggcagtactg
ctgatgattgcggtatttattccggcacagtatttcagctatctggaaggaatgctgtta
acctggggcgtagttgctataagcttcgtgctctactccatgattgcaggcacactgcag
aaccgtaaaaacaggtttctgatgatggtcagcatagagagtctaagtgtagttatcatc
ttctatctggtcagcttcagcagtgcgccgttccattattatgtattgtcctatgaaata
atattgttcggtttcgtccaggcgattctgatgacccgccagtacgcggcatcctttctg
gaagtggagcagctgtcccgcaggctgcttacactggacgggctgaaggatgacttcatg
gccgctacctcaagtgaactgcgcatgcctctacaggggattgtaaatattgcccagaca
ctgacggagggggcggcaggacggctgaatgcccagcagagcggacagctgtccatgatt
gtatcaaccggaaaaaggctgtccgccctgatcaacgatatggccgactttgccaagctg
aaccacggcggccttttcctgcagagacaggctgttgatctgcacagtgttgcctcctct
gtcattgaggttacccgtcatgttacaggcaatccgaagctgagcttccggctggagctg
ccggatacgctgccgctgctggaaacggatgaacagcggctgggccagattttgttcaat
cttttggctaacgctgtaaattacacccagcagggtgtgattacggtgtcagcggaggtt
aaagaagattatgtggtcatccaggtggctgataccggatcgggaatgccgcccgagcgg
ctccggacgatatttgacgcctatgatccgcagggtgcatccgcccagaagctgtaccgt
gagaacgggctgggcctcagcattacccagaagctggtagagcttaacgggggagagatt
gaggggcagtccatccttggccagggaacaaggttccgcttcaccctgccggtgcttaag
gacccggcggcctttcttgatcagagctatatggaggttaccggctgggaaactgcagcc
tcctccgagaccgcatataatgagctggggctgctgctggacgcggagtgctgcaagatt
ctggttgttgagaatgatccggtcaaccagcaggtgctctcgaatatcctcaagctggag
cggcatttggttataacggcggccagcggtccggaagcgcttctgattatgcaggagcag
ccggatatcgaccttgttattatggactgggccatacccgagatgcccggactggtgctg
tgccaggccatccgcgagcggttcgttttatcagagctgccgatccttgtcctgacggcc
ggtaaccggcctgaggatatacaggccatctttgaggccggggctaacgactatttaatc
cagccggtggagcttcgtgaattccgggcccgtgtacagacgctgctcgatatgcgcaag
ctgatccggaagtctgtcgagacggaaattgcctttctgcaggcacagatcaaaccgcat
tttttgtacaacgcgcttaatgccattatctcggtatgtccggatgatccggataaagcg
acagacctgctgctggatctcagcatgtatctgcgcagcagctttgatttccagaaccgc
ggacagacagtgcctgtcgagaaggagctggagctggtacggtcttatcttgcgctggag
aaggccaggtttgatgaccggctgaatattgaatttgacctgcctgagcgtatccgggag
ctgattcccccgctcagcattcagccgattgtagagaatgcagtgaatcacgggctgatg
cagaaggaagccggcggaaccgttacgctgtccatccgtctgctggaccgccagctggtt
gtagccgtgtcggacgatggaataggcatgacgcaggatcggatcggggaggttctgtct
gaagaacgcaccgagggcggaatcggactgagaaatatccagcggcggctgcttaaaatt
tacggaacgggcctgattatcgaaagcgtgcctggagctggaacgaggatctcctacgct
attccgcggacgcatccggtatcagaatga

DBGET integrated database retrieval system