KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_0859Help
Entry
NCGM1900_0859     CDS       T03789                                 

Definition
(GenBank) putative short-chain dehydrogenase
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind Oxidored_nitro GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-ProteinID: BAP19983
UniProt: A0A069QC10
LinkDB All DBs
Structure
PDB: 

Position
complement(905802..906527)
Genome map
AA seq 241 aa AA seqDB search
MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWID
TPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccagcacgatatctacgccggccagcaggtgctggtcactggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggacgccgacggcgtgcacgcaccgcgtcatccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagcgctgccgcgcctggatgtg
ctggtgaacaacgccggcatcagccgcgaccgcgaggaatacgacctggcgaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccaactggcccgtccgctg
ctggcacagcgcggcggcagcatcctcaacatcgcctcgatgtacagcaccttcggttcc
gccgaccgcccggcctacagcgccagcaagggcgccatcgtccagctcacccgttccctg
gcctgcgagtatgccgccgagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgtcgaggccacccgccggatcatgcagcgc
acgccgctggcgcgctggggcgaggcgcccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctatctctgc
gcctga

DBGET integrated database retrieval system