KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_0860Help
Entry
NCGM1900_0860     CDS       T03789                                 

Gene name
ydjL
Definition
(GenBank) Zn-dependent putative alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCGM1900_0860 (ydjL)
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NCGM1900_0860 (ydjL)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NCGM1900_0860 (ydjL)
    1.1.1.-  
     NCGM1900_0860 (ydjL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: BAP19984
UniProt: A0A4U0K2Y0
LinkDB All DBs
Position
complement(906542..907600)
Genome map
AA seq 352 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGLRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARMPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDC
AFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPEL
IALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQVKVLVNPNPALADA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgccgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctgaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggactgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcggatgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctt
ggcccgatcggtctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgcc
gcggtcgacgtcagtcccgagcgcctcgccctggccggcgaattcggcgccagccgggcg
ctcgacgcccgtgacggcgacacggcggcgcgcctgcgcgaaggcggcgcgctcgattgc
gccttcgaggccgccggcagccaggccagcctcgacgccgccctggccagcctgcgcaag
ggtggcgagctggtgctggtgagcctgatgggcgaggtcaggctggacgccttcgacctg
gtcaaccgcgaactgcgcctgctcggcagcgtcggctaccgcgacgcctacccggagctg
atcgccctgctcgccgatggccgcctcgacctggcccgcgcagtgacccgcagcgtgccc
ctggagcaggccgtcgagcacggtttcgaggccctgctgcgcgacaagtcgcaggtcaag
gtgctggtcaatcccaacccggccctggccgacgcctga

DBGET integrated database retrieval system